[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62499.1
DDBJ      :             coenzyme PQQ synthesis protein, conjectural
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  482/915 : Eukaryota  2/199 : Viruses  1/175   --->[See Alignment]
c.1.28d.350.1
:222 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->83 3c8fA PDBj 2e-06 29.9 %
:RPS:PDB   10->217 2a5hA PDBj 8e-13 13.0 %
:RPS:SCOP  34->118 2h7aA1  d.350.1.1 * 2e-08 8.3 %
:HMM:SCOP  27->198 1tv8A_ c.1.28.3 * 1e-09 25.9 %
:RPS:PFM   34->116 PF04055 * Radical_SAM 2e-05 35.4 %
:HMM:PFM   30->117 PF04055 * Radical_SAM 3.9e-15 29.8 84/166  
:BLT:SWISS 11->133 YGCF_SHIFL 5e-17 47.8 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62499.1 GT:GENE AAL62499.1 GT:PRODUCT coenzyme PQQ synthesis protein, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(4483..5151) GB:FROM 4483 GB:TO 5151 GB:DIRECTION - GB:PRODUCT coenzyme PQQ synthesis protein, conjectural GB:NOTE Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone GB:PROTEIN_ID AAL62499.1 GB:DB_XREF GI:18159047 LENGTH 222 SQ:AASEQ MSATPRVRVLEIFASLQGEGINLGRPAVFVRLAGCPIRCIYCDTKYSWDFNAGVEMGVEEIVAKALALSVVGHVVVTGGEPLIWQRRGLEELACALRALGSVEVETSGAYPPTPELDRCVDFYDVSPKLSNAGVKAPFSPFYASSPKAWFKFVVSNADDVEEVERFVVAYGIPRGRVFLMPMAESPEEHGEALRRIWDAAVRGGFRVTPRLHIMAWGNARGK GT:EXON 1|1-222:0| BL:SWS:NREP 1 BL:SWS:REP 11->133|YGCF_SHIFL|5e-17|47.8|115/223| TM:NTM 1 TM:REGION 60->81| BL:PDB:NREP 1 BL:PDB:REP 2->83|3c8fA|2e-06|29.9|77/245| RP:PDB:NREP 1 RP:PDB:REP 10->217|2a5hA|8e-13|13.0|208/400| RP:PFM:NREP 1 RP:PFM:REP 34->116|PF04055|2e-05|35.4|82/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 30->117|PF04055|3.9e-15|29.8|84/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 1 RP:SCP:REP 34->118|2h7aA1|2e-08|8.3|84/109|d.350.1.1| HM:SCP:REP 27->198|1tv8A_|1e-09|25.9|158/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 536 OP:NHOMOORG 521 OP:PATTERN ---1-11111111111--11111-1111--1-1-111------11111-------------111--11 111--------------------------------------111------------------1--------------------111111111-111---111111111-1---------------1111-11-111--------1--11-111--11111111111111111111111111111------111-11111111111111111111111111--112------1111111111111111111-11----------------------------------11---------------------------111----1--112222222-2-----1-----2---1-----1-1---1----1----11---------1-------1--111-111111111------1---2--1--111111-11-------1-----1-------------11--------------111111111-111-----11-1------111111111111112111111111-------1--1----111--1111111-1111111111111111-11---------1-------11111111111-11111---1--1111--1--1-1111111-12111112111111111111111111--1--11-----11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1111111111111---1111111111-1--111111111111111112111111111111----------1111111111111111111111111111111---1111----------------------------------------------111 --------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------1----------------------- -------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------- STR:NPRED 216 STR:RPRED 97.3 SQ:SECSTR #cTTcccccTcTTTccccTTEEcccccEEEEEEEcccccTTcTTTTTTTccccccHHHHHHHHHHHTcTTccEEEEEEccTTcccHHHHHHHHHHHHTcTTccEEEEEccHHHHcGGGccHHHHHHGGGccHHHHHHHHHHHHTTccEEEEEEcTccHHHHHHHHHHHHTTEEEEEEEcccccTcHHHHHHHHHTTcTTccGGGccEEEEEETTTTE##### DISOP:02AL 1-2| PSIPRED ccccccEEEEEEEEcccccccccccEEEEEEEccccccccccccHHHccccccccccHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHccccEEEEEccccccHHHHHHHccEEEEccccccHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEEcccccc //