[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62515.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->122 3dboB PDBj 2e-06 33.9 %
:RPS:PDB   6->124 3dboB PDBj 1e-12 26.7 %
:RPS:SCOP  6->124 1v8oA  c.120.1.1 * 1e-11 19.3 %
:HMM:SCOP  4->113 1y82A1 c.120.1.1 * 3.2e-18 32.1 %
:HMM:PFM   8->118 PF01850 * PIN 4.5e-17 31.7 104/126  
:BLT:SWISS 9->114 Y914_METJA 3e-10 35.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62515.1 GT:GENE AAL62515.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 14898..15275 GB:FROM 14898 GB:TO 15275 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62515.1 GB:DB_XREF GI:18159064 LENGTH 125 SQ:AASEQ MGASQRALLDTSVLIEILDKGRLSLLPKDPYLSVISIYEYIRYKRDRHFYKERLEEAFSVLGLTNKVIERAAEIFASLKARGVVVSDNDVFIAATAVAYGLPLITKDRYFLKIKTAAGLDVVFID GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 9->114|Y914_METJA|3e-10|35.6|104/136| BL:PDB:NREP 1 BL:PDB:REP 8->122|3dboB|2e-06|33.9|112/126| RP:PDB:NREP 1 RP:PDB:REP 6->124|3dboB|1e-12|26.7|116/126| HM:PFM:NREP 1 HM:PFM:REP 8->118|PF01850|4.5e-17|31.7|104/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 6->124|1v8oA|1e-11|19.3|119/132|c.120.1.1| HM:SCP:REP 4->113|1y82A1|3.2e-18|32.1|109/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------1--111------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 120 STR:RPRED 96.0 SQ:SECSTR #####EEEEccGGGcccccGHHHGGcccEEEEEHHHHHHHHHHHHHHHHHHHHTTTTccEEcccHHHHHHHHHHHHHHHHHTccccHHHHHHHHHHHHTTccEEEccccGGGGTTcTTccEEEcH DISOP:02AL 1-3| PSIPRED cccccEEEEHHHHHHHHHcccHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccEEEEcccHHHHHHHHcccEEEEEc //