[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62540.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:87 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   31->71 PF11937 * DUF3455 0.00055 31.7 41/182  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62540.1 GT:GENE AAL62540.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(38113..38376) GB:FROM 38113 GB:TO 38376 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62540.1 GB:DB_XREF GI:18159091 LENGTH 87 SQ:AASEQ MIFRNYADVLYDLAKEWCNCDNRRWQGEECDEVEKLAESVKWLYLYAEGGYGEKAYDAASTLTRIAAGGGRVANLAMRLAKLAEELL GT:EXON 1|1-87:0| HM:PFM:NREP 1 HM:PFM:REP 31->71|PF11937|0.00055|31.7|41/182|DUF3455| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHc //