[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62547.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.58
:95 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->77 2ivyA PDBj 1e-05 31.2 %
:RPS:SCOP  2->77 2i8eA1  d.58.58.1 * 3e-20 30.3 %
:HMM:SCOP  1->79 1zpwX1 d.58.58.1 * 2.5e-11 32.1 %
:HMM:PFM   1->69 PF09827 * CRISPR_Cas2 5.6e-14 33.8 68/79  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62547.1 GT:GENE AAL62547.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(43194..43481) GB:FROM 43194 GB:TO 43481 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62547.1 GB:DB_XREF GI:18159098 LENGTH 95 SQ:AASEQ MIWLAVYDIEDDGERAKASAILQAWGFVRVQRSFYVGRMPRGKAADLLKILQRHVKSGHIALIPITDELLAKALELGRPPYAPLKPPKYAQIYVV GT:EXON 1|1-95:0| SEG 79->90|ppyaplkppkya| BL:PDB:NREP 1 BL:PDB:REP 1->77|2ivyA|1e-05|31.2|77/88| HM:PFM:NREP 1 HM:PFM:REP 1->69|PF09827|5.6e-14|33.8|68/79|CRISPR_Cas2| RP:SCP:NREP 1 RP:SCP:REP 2->77|2i8eA1|3e-20|30.3|76/88|d.58.58.1| HM:SCP:REP 1->79|1zpwX1|2.5e-11|32.1|78/0|d.58.58.1|1/1|TTP0101/SSO1404-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------11--1--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 77 STR:RPRED 81.1 SQ:SECSTR EEEEEEEEEccHHHHHHHHHHHHHTTcEEEETTEEEEEEcHHHHHHHHHHHTccccccTEEEEEEcHHHHHTccccc################## PSIPRED cEEEEEEEccccHHHHHHHHHHHHcccEEEEEEEEEEEccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHEEcccccccccccccEEEEEc //