[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62561.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   6->121 2bsqA PDBj 2e-07 17.4 %
:RPS:SCOP  6->115 2fe1A1  c.120.1.1 * 3e-07 19.6 %
:HMM:SCOP  1->121 1w8iA_ c.120.1.1 * 2.1e-17 29.9 %
:HMM:PFM   6->115 PF01850 * PIN 5.7e-13 27.8 108/126  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62561.1 GT:GENE AAL62561.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 54323..54703 GB:FROM 54323 GB:TO 54703 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62561.1 GB:DB_XREF GI:18159113 LENGTH 126 SQ:AASEQ MYRKWIYVDVNVLYYFFTAHPEYGEGSRELIKKYAGRLATSALTAWLLYVLTRNEGIVEATRDLTTLLPLDVEVLNKAKRLNKPRDFEDRIHLATMQIYGIDTILSNDGDFDEAGVQRIAPRRKGE GT:EXON 1|1-126:0| RP:PDB:NREP 1 RP:PDB:REP 6->121|2bsqA|2e-07|17.4|115/143| HM:PFM:NREP 1 HM:PFM:REP 6->115|PF01850|5.7e-13|27.8|108/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 6->115|2fe1A1|3e-07|19.6|107/130|c.120.1.1| HM:SCP:REP 1->121|1w8iA_|2.1e-17|29.9|117/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------111------------------------------------1---------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 115 STR:RPRED 91.3 SQ:SECSTR #####EEEcHHHHHGGGcccccHHH#HHHHHTccGGGEEEEHHHHHHHHHHHTccccHHHHHHHHHHHcccHHHHHHHHHHHHHHTTcccccHHHHHHTTcEEEcccHHHHGGGTccEEcT##### DISOP:02AL 122-126| PSIPRED cccEEEEEEHHHEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccHHHHHHHHHcccccccHHHEEEEEEEEEcHHHEEcccccccHHHHHHHccccccc //