[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62583.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:146 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   20->90 PF07332 * DUF1469 0.00026 25.0 68/121  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62583.1 GT:GENE AAL62583.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(74890..75330) GB:FROM 74890 GB:TO 75330 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62583.1 GB:DB_XREF GI:18159137 LENGTH 146 SQ:AASEQ MVPPEKALNPAVLELLKVSMALEVAFGLVSLTWVLAVVSSLAYILSFFFTPLAGAVVLIIAAVYITLGYSTVFAAYRIIKNPASLKPSESLFWSKLALVASALSFLGGNVLYGTSSALMALSLYLYTKERAAKSYELRIPKAINVG GT:EXON 1|1-146:0| TM:NTM 3 TM:REGION 16->38| TM:REGION 56->78| TM:REGION 90->112| SEG 52->67|lagavvliiaavyitl| SEG 115->126|ssalmalslyly| HM:PFM:NREP 1 HM:PFM:REP 20->90|PF07332|0.00026|25.0|68/121|DUF1469| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7| PSIPRED cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHccccEEccHHHHHHHHHHHHHHHHHHcHHHEEcccccccc //