[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62585.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   49->120 PF07155 * DUF1393 0.00025 27.8 72/169  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62585.1 GT:GENE AAL62585.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(75923..76297) GB:FROM 75923 GB:TO 76297 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62585.1 GB:DB_XREF GI:18159139 LENGTH 124 SQ:AASEQ MSSKQGSLVGAVLLGFIANVAFGFIVPAVNELIGGALAGYIAGGTLARGALAGFLAGILGGLILSLIILALLPLFMPILAPILGPFTGLLPLTALIPIIFSLKGALLSAIGGVIGNLIAAYTKK GT:EXON 1|1-124:0| TM:NTM 3 TM:REGION 14->36| TM:REGION 56->78| TM:REGION 95->117| SEG 32->83|liggalagyiaggtlargalagflagilgglilsliilallplfmpilapil| HM:PFM:NREP 1 HM:PFM:REP 49->120|PF07155|0.00025|27.8|72/169|DUF1393| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //