[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62589.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->32 PF10599 * Nup_retrotrp_bd 0.00044 34.8 23/105  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62589.1 GT:GENE AAL62589.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(77664..77840) GB:FROM 77664 GB:TO 77840 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62589.1 GB:DB_XREF GI:18159144 LENGTH 58 SQ:AASEQ MASRFKKFLQPQQHQEQAASPPFTPGASGDTGDGRLVLLFAGDMTQLILQEHKAYDKS GT:EXON 1|1-58:0| HM:PFM:NREP 1 HM:PFM:REP 10->32|PF10599|0.00044|34.8|23/105|Nup_retrotrp_bd| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 8-26, 53-58| PSIPRED ccHHHHHHcccHHHHHHcccccccccccccccccEEEEEEcccHHHHHHHHHHHcccc //