[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62612.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  26/68 : Bacteria  23/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:408 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   45->169 3akyA PDBj 5e-04 12.7 %
:RPS:SCOP  27->103 1odfA  c.37.1.6 * 5e-05 26.3 %
:HMM:SCOP  5->212 2fnaA2 c.37.1.20 * 5e-12 28.0 %
:RPS:PFM   40->105 PF01637 * Arch_ATPase 2e-05 38.1 %
:HMM:PFM   39->83 PF01637 * Arch_ATPase 7.8e-07 34.9 43/234  
:BLT:SWISS 43->179 Y1637_METJA 4e-05 31.0 %
:BLT:SWISS 183->260 COFG_SYNP6 9e-04 37.1 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62612.1 GT:GENE AAL62612.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 89519..90745 GB:FROM 89519 GB:TO 90745 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62612.1 GB:DB_XREF GI:18159168 LENGTH 408 SQ:AASEQ MDFLNPWWRGRLEEDPQLAKWAESPVRWIPKWVYEVDLTPFSLHFLLGPRQVGKTTALKLLIKRLVEEGRDPRSIFYYSCELVSDHRELAEVLREVAKLKERWGVASALIILDEVTYPREWYRALKFFIDQGFFKNDVIIASGSVSMYAKREVETFPGRRGRGRDYVLYPLSFAAFAKLAGVPEGADPAAWRSKLAELLELYLDCGGMPTSVISCLTGRGADSQTWQIFISSLSFDLARLGRSEAYVKRLLRAVLRTAPSPVSLSALAKEAELTSHKIAFTYLNLLEGLYILKQLFWVNPYTLEESFKKPRKIHLQDPAMYSAFARWVGVDPPGAEVRLEAAVATHLARKYRVGYWRDGREIDVIIPELKAGIEVKIGRAGAGGRVGLVKYRELSLPDAAEYLFGEVP GT:EXON 1|1-408:0| BL:SWS:NREP 2 BL:SWS:REP 43->179|Y1637_METJA|4e-05|31.0|126/473| BL:SWS:REP 183->260|COFG_SYNP6|9e-04|37.1|70/336| SEG 378->389|gragaggrvglv| RP:PDB:NREP 1 RP:PDB:REP 45->169|3akyA|5e-04|12.7|110/218| RP:PFM:NREP 1 RP:PFM:REP 40->105|PF01637|2e-05|38.1|63/208|Arch_ATPase| HM:PFM:NREP 1 HM:PFM:REP 39->83|PF01637|7.8e-07|34.9|43/234|Arch_ATPase| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01637|IPR011579| RP:SCP:NREP 1 RP:SCP:REP 27->103|1odfA|5e-05|26.3|76/280|c.37.1.6| HM:SCP:REP 5->212|2fnaA2|5e-12|28.0|186/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 83 OP:NHOMOORG 49 OP:PATTERN ------12111211221-2-331--------------------------12-1-45222-2-1-2--- ------------------------------------------------------------------------------------12-------------------------------------------1--1-----------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1-----------1--------------------------------------------------------------------------------------------------------------------------------------------------------------33323--1---------------------------------------------------------------------------------------------------------------------------------------3-111111---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 110 STR:RPRED 27.0 SQ:SECSTR ############################################EEEccTTccHHHHHHHHHHHH########ccEEEE####HHHHHHHHHHTTcHHHHHHHHHHTTTccccHHHHHHHHHHHHHHcGGG###GccEEEEcccccHHHHHHHHHHHHHHTccccEEEE############################################################################################################################################################################################################################################### DISOP:02AL 146-158| PSIPRED cccccccccccccccHHHHHHHHHHcHHHHHHHHHcccccccEEEEEccccccHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHccHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHHHccccccEEEEEEEccccHHHHHHHcccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccEEEEcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccEEEEEccEEEEEEEcccEEEEEEEEcccccccHHHHHHHHccccccHHHHHccccc //