[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62614.1
DDBJ      :             thiamine biosynthetic enzyme (thi1)
Swiss-Prot:THI4_PYRAE   RecName: Full=Putative thiazole biosynthetic enzyme;

Homologs  Archaea  57/68 : Bacteria  14/915 : Eukaryota  88/199 : Viruses  0/175   --->[See Alignment]
c.3.1
:261 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->254 2gjcA PDBj 7e-18 29.2 %
:RPS:PDB   6->43 1chuA PDBj 9e-07 25.7 %
:RPS:PDB   25->54 1b37A PDBj 2e-09 36.7 %
:RPS:SCOP  1->252 1rp0A1  c.3.1.6 * 5e-16 23.8 %
:HMM:SCOP  2->254 2gjcA1 c.3.1.6 * 1.9e-44 35.2 %
:RPS:PFM   19->89 PF01946 * Thi4 9e-08 42.3 %
:HMM:PFM   7->234 PF01946 * Thi4 6.9e-81 46.7 227/230  
:BLT:SWISS 1->261 THI4_PYRAE e-132 100.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62614.1 GT:GENE AAL62614.1 GT:PRODUCT thiamine biosynthetic enzyme (thi1) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(90956..91741) GB:FROM 90956 GB:TO 91741 GB:DIRECTION - GB:PRODUCT thiamine biosynthetic enzyme (thi1) GB:NOTE Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine GB:PROTEIN_ID AAL62614.1 GB:DB_XREF GI:18159170 LENGTH 261 SQ:AASEQ MELKIGRAIISHALKDLDEYSDVDVAIVGAGPAGLTAARYLAEKGLKVVVYERRFSFGGGIGPGGNMLPKIVVQEEAVPILRDFKVRYKPAEDGLYTVDPAELIAKLAAGAVDAGAKIILGVHVDDVIFRGDPPRVTGLLWIWTPIQMSGMHVDPLYTQAKAVIDATGHDAEVVSVAARKVPELGIQVVGEKSAWSEVSEKLVVEHTGRVAPGLYVAGIAVCAVYGLPRMGPIFGGMLMSGKKVAEVVYKDLMAEAHAVRA GT:EXON 1|1-261:0| SW:ID THI4_PYRAE SW:DE RecName: Full=Putative thiazole biosynthetic enzyme; SW:GN OrderedLocusNames=PAE0175; SW:KW Complete proteome; FAD; NAD; Thiamine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->261|THI4_PYRAE|e-132|100.0|261/261| GO:SWS:NREP 1 GO:SWS GO:0009228|"GO:thiamin biosynthetic process"|Thiamine biosynthesis| TM:NTM 3 TM:REGION 105->127| TM:REGION 206->228| TM:REGION 231->253| SEG 58->65|gggigpgg| SEG 103->118|liaklaagavdagaki| BL:PDB:NREP 1 BL:PDB:REP 2->254|2gjcA|7e-18|29.2|250/301| RP:PDB:NREP 2 RP:PDB:REP 6->43|1chuA|9e-07|25.7|35/478| RP:PDB:REP 25->54|1b37A|2e-09|36.7|30/459| RP:PFM:NREP 1 RP:PFM:REP 19->89|PF01946|9e-08|42.3|71/80|Thi4| HM:PFM:NREP 1 HM:PFM:REP 7->234|PF01946|6.9e-81|46.7|227/230|Thi4| GO:PFM:NREP 1 GO:PFM GO:0009228|"GO:thiamin biosynthetic process"|PF01946|IPR002922| RP:SCP:NREP 1 RP:SCP:REP 1->252|1rp0A1|5e-16|23.8|252/278|c.3.1.6| HM:SCP:REP 2->254|2gjcA1|1.9e-44|35.2|253/0|c.3.1.6|1/1|FAD/NAD(P)-binding domain| OP:NHOMO 174 OP:NHOMOORG 159 OP:PATTERN 1111111111111111-111111111111111--111111111--11111111111111-----1-11 ---------------------------------------------------------------------------------------------1-----------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111111--- --------------111111111111111111111111-11111111111111111111311111----1111111111-11111111-121111------1-1-1----------------------------------------------------------------------12-----116134111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 253 STR:RPRED 96.9 SQ:SECSTR #HHcHcHHHHHHHHHHTccccEEEEEEEcccHHHHHHHHHHHHTTcccEEEEccccccTTGGGccccEEccccHHHHHTTccccHHHHHHHHHTTTcccHHHHHHHHHHHHHTcTTEEEETTHHHHHHHHHHHHHHHHHHHTTccccEEEccTTcccccEEEccccccHHHHHHHHHHHHHHHTTcEEEccEEEcHHHHEEEEEcccccEETTEEEcTHHHHHHHTccccccccHHHHHHHHHHHHHHHHHHHc####### DISOP:02AL 260-261| PSIPRED cccEEHHHHHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHcccEEEEccccEEEEEHHHHHHHHHHHHHHcccEEEEcEEEEEEEEEccccEEEEEEEcccEEEEEccccccEEEEEEEEEEEccccHHHHHHHHHHHHHcccEEccccccccccccccEEEEccEEccccEEEEccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //