[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62622.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:282 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   9->277 PF06023 * DUF911 2e-67 48.1 %
:HMM:PFM   1->277 PF06023 * DUF911 2.1e-108 46.6 277/290  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62622.1 GT:GENE AAL62622.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(102756..103604) GB:FROM 102756 GB:TO 103604 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62622.1 GB:DB_XREF GI:18159179 LENGTH 282 SQ:AASEQ MLTLQEIARLLRRAKITWGPVEISPEYRGWNYDKPPVKPPAYLGLALSDFAYGYCPTGRNIYLKYVLGERGAAVKALVEGQALHQALFKALEDYKKYAYSGHPMSPSFEGVPEDVRPKAEALYKYVATRLLGEHSYVSAARLARSRDSAVFYTAPIATQVAVDGSPLGMSYVVADGVALGAVIEFKFGPAQNVDAALAGYAMAIEADWGVPIDYGIHVQITVNSTVEYKATAYPLGDSARTKFLELRDEAIDIVIAGRDPGVAPDCPKTCPFYHICHADRSR GT:EXON 1|1-282:0| SEG 138->149|saarlarsrdsa| RP:PFM:NREP 1 RP:PFM:REP 9->277|PF06023|2e-67|48.1|268/284|DUF911| HM:PFM:NREP 1 HM:PFM:REP 1->277|PF06023|2.1e-108|46.6|277/290|DUF911| OP:NHOMO 29 OP:NHOMOORG 23 OP:PATTERN 1111111-12211122--211-21----------------------------------------1--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 279-282| PSIPRED cccHHHHHHHHHHHHcccccccccHHHccccccccccccccHHcccHHHHHHccccccccEEEEEEHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHEEEEEEEEEEEccccccccHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHEEEHHHcccEEEEEEEEEEEcccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHcccccc //