[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62628.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:230 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   4->182 PF09704 * Cas_Cas5d 3.8e-19 22.4 165/216  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62628.1 GT:GENE AAL62628.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(109280..109972) GB:FROM 109280 GB:TO 109972 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62628.1 GB:DB_XREF GI:18159186 LENGTH 230 SQ:AASEQ MNILLVKLRLPLFSIKHYETYQVAATLPFIPPSTVVGALVQAAARGGLCEGDCLAEVRGWIYKARDVAAPTVKFPVVLKRARGVLEEGKLPLSGEELGGYFDAMVREYAYVAEKAVLVVPSAEAHIGRLEKALWLLERVGDTESYVSVRGVEVLNARPCGAGEVDVAVKLAKVAGGAHLVVRAGDEDGTLSDFAVPLATGGKGYYTPTKIAVKSDVFCAGDVAFPAGHDW GT:EXON 1|1-230:0| SEG 164->177|vdvavklakvagga| HM:PFM:NREP 1 HM:PFM:REP 4->182|PF09704|3.8e-19|22.4|165/216|Cas_Cas5d| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN 11----------------1---1--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 85-95| PSIPRED cHHEEEEHHccEEEEEcccHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHccEEEEccccccccccHHHHHHHHHHHHHHccccccccccccccccEEccEEEccccEEEEEEEccccHHHHHHHHHHHHEEcccEEEEEEEccEEEEccccccccccHHHHHHHHcccEEEEEEEcccccccccEEEEEEEcccccccccEEEEEccEEEEccccccccccc //