[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62667.1
DDBJ      :             signal peptidase
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  2/915 : Eukaryota  33/199 : Viruses  0/175   --->[See Alignment]
b.87.1
:188 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  33->132 1f39A  b.87.1.1 * 1e-07 15.1 %
:HMM:SCOP  25->83 1b12A_ b.87.1.2 * 4.4e-06 35.1 %
:HMM:PFM   34->89 PF00717 * Peptidase_S24 2.3e-09 25.5 51/70  
:HMM:PFM   150->177 PF04971 * Lysis_S 0.00022 44.4 27/68  
:BLT:SWISS 25->136 SC11A_PONAB 6e-11 43.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62667.1 GT:GENE AAL62667.1 GT:PRODUCT signal peptidase GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 145542..146108 GB:FROM 145542 GB:TO 146108 GB:DIRECTION + GB:PRODUCT signal peptidase GB:NOTE Protein fate; Protein and peptide secretion and trafficking GB:PROTEIN_ID AAL62667.1 GB:DB_XREF GI:18159227 LENGTH 188 SQ:AASEQ MKGWVKDLIWFAGIVAALLAYSLATGVAWPIAVVSSYSMEPTMRVGDFVFLTGATCTSIQPGEVVVYVARNPMWYGNWIIHRVYQKQNSGGQCGLVTWGDNNPFPDQRVGEPLVSNNVVGKVLFTVPYIGVFPLVVRPQGIGDIAIAAWLGRLFIFGAVTYAFYLYFKAAEKKPKKKRLSSTKKGKGI GT:EXON 1|1-188:0| BL:SWS:NREP 1 BL:SWS:REP 25->136|SC11A_PONAB|6e-11|43.3|104/179| TM:NTM 3 TM:REGION 11->33| TM:REGION 117->139| TM:REGION 144->166| SEG 168->187|kaaekkpkkkrlsstkkgkg| HM:PFM:NREP 2 HM:PFM:REP 34->89|PF00717|2.3e-09|25.5|51/70|Peptidase_S24| HM:PFM:REP 150->177|PF04971|0.00022|44.4|27/68|Lysis_S| RP:SCP:NREP 1 RP:SCP:REP 33->132|1f39A|1e-07|15.1|86/101|b.87.1.1| HM:SCP:REP 25->83|1b12A_|4.4e-06|35.1|57/247|b.87.1.2|1/1|LexA/Signal peptidase| OP:NHOMO 69 OP:NHOMOORG 51 OP:PATTERN --111-------------11112------------------------------11-11111---1--- ----------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------1----------------------------------11-------------------------------------------------2-11-1----1-11---1-391-122---11--2--11--11-1-2121-2----1-1-----1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 171-188| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccEEcccEEEEEcccccccccccEEEEEEcccccccccEEEEEEEEEEcccEEEEEEEccccccccccccccccHHHEEEEEEEEEccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc //