[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62673.1
DDBJ      :             Rieske iron sulfur protein, putative
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.33.1
:96 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   28->94 2yvjB PDBj 4e-09 33.3 %
:RPS:PDB   21->93 1bccE PDBj 3e-10 15.7 %
:RPS:SCOP  21->93 1vm9A  b.33.1.1 * 1e-09 24.3 %
:HMM:SCOP  21->95 1jm1A_ b.33.1.1 * 2.2e-11 29.3 %
:RPS:PFM   26->69 PF00355 * Rieske 1e-06 43.2 %
:HMM:PFM   21->80 PF00355 * Rieske 1.7e-13 26.7 60/97  
:BLT:SWISS 2->33 UL16_HHV6U 2e-04 40.6 %
:BLT:SWISS 28->94 BPHA3_PSES1 1e-08 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62673.1 GT:GENE AAL62673.1 GT:PRODUCT Rieske iron sulfur protein, putative GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 150134..150424 GB:FROM 150134 GB:TO 150424 GB:DIRECTION + GB:PRODUCT Rieske iron sulfur protein, putative GB:NOTE Energy metabolism; Electron transport GB:PROTEIN_ID AAL62673.1 GB:DB_XREF GI:18159234 LENGTH 96 SQ:AASEQ MRIKIKDLAENAITPLPELGAFAVKRGGEIYVYKDECPHAYCNFTTSGQLEGDYIICTCHWCKFDLRTGASLTPELTAEPLRKISFKVEGEELVFT GT:EXON 1|1-96:0| BL:SWS:NREP 2 BL:SWS:REP 2->33|UL16_HHV6U|2e-04|40.6|32/335| BL:SWS:REP 28->94|BPHA3_PSES1|1e-08|33.3|66/109| BL:PDB:NREP 1 BL:PDB:REP 28->94|2yvjB|4e-09|33.3|66/106| RP:PDB:NREP 1 RP:PDB:REP 21->93|1bccE|3e-10|15.7|70/196| RP:PFM:NREP 1 RP:PFM:REP 26->69|PF00355|1e-06|43.2|44/95|Rieske| HM:PFM:NREP 1 HM:PFM:REP 21->80|PF00355|1.7e-13|26.7|60/97|Rieske| GO:PFM:NREP 3 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00355|IPR017941| GO:PFM GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|PF00355|IPR017941| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00355|IPR017941| RP:SCP:NREP 1 RP:SCP:REP 21->93|1vm9A|1e-09|24.3|70/109|b.33.1.1| HM:SCP:REP 21->95|1jm1A_|2.2e-11|29.3|75/202|b.33.1.1|1/1|ISP domain| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------111----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 84 STR:RPRED 87.5 SQ:SECSTR ###########cGGGHTTccGGGccccTTEEEEEcccTTTccccEEEEETTTEEEEETTTTEEEETTccEEEcccccccccccccEEEccccEcE# PSIPRED ccccccccccccEEEccccEEEEEEEccEEEEEcccccccccEEccccEEEccEEEEcccccEEEcccccEEcccccccccEEEEEEEEccEEEEc //