[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62678.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:494 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 167->370 DOPO_HUMAN 8e-04 26.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62678.1 GT:GENE AAL62678.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(153585..155069) GB:FROM 153585 GB:TO 155069 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62678.1 GB:DB_XREF GI:18159239 LENGTH 494 SQ:AASEQ MRLLPISFLAAFALALCVGDQYLVSYTIYTTGVEISFFNRANLSLVSYINLEGFAETAEETCALRGDILYIPFGSQILAVAPGGVIGSVDLPGERVYSVVYACGEVISLSGNHSRACLRAFSPDLKALRLLELNASEAFLNSMQAMGCDVVVVGSNADKSIIYYIANWQVAYVKEVRGYGKLIRDINGSVYFITKERLYKVTRSGLALLWPVGEVHYLARGFGRGGVVYLLMQGKIVVLKPGGVKEEIYGAALYDLGTDGFNLYLMPSKTVLRRHSHVPNGTLTVIARGVEGVSLLNVGVEGIGSARGLLYGPVKVHSGWYWAYIELCGKSIPRRVAVSDGANVYVEIPFDGVWISIDAVDFWGRSAELPAYVTVYTIANAQIYPTKCSYLSPRSKVDVPLLKGGEYLIRYCNKAGVSGVGLYSEESKCEGFRVKIWDNGMVFVLDEDYYSAGIGGGRYVKRFDGVYYAEIITMAVLLGLIYAVDKLIKRRRPQ GT:EXON 1|1-494:0| BL:SWS:NREP 1 BL:SWS:REP 167->370|DOPO_HUMAN|8e-04|26.7|176/100| TM:NTM 2 TM:REGION 3->25| TM:REGION 465->487| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 492-494| PSIPRED cEEEHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEEccccEEEEEEEEcccHHHHHHHHHEEcccEEEEEcccEEEEEEcccEEEEccccHHHHHHHHHHHccEEEEcccccHHHHHHccccccEEEEEEcccHHHHHHHHHHccccEEEEccccccEEEEEEEccEEEEHHHHHHHHHHHHHccccEEEEEHHHHHHHHHccEEEEEEccHHHHHHHccccccEEEEEEEcEEEEEccccccHHHHEEEEEEcccccEEEEEEccHHHHHHHccccccEEEEEEEccccEEEEEcccccccccccEEEEEEEEEccEEEEEEEHHccccccEEEEccccEEEEEcccccEEEEEEEEEEccccccccEEEEEEEEEccEEEEccccccccccccccEEEcccHHHHHHHHHccccEEEEcccccccccEEEEEEcccEEEEEEcccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHcccc //