[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62683.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:130 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  6->121 2fe1A1  c.120.1.1 * 2e-05 20.0 %
:HMM:SCOP  1->116 1w8iA_ c.120.1.1 * 6.8e-07 26.2 %
:HMM:PFM   20->126 PF01850 * PIN 4.9e-07 23.2 95/126  
:BLT:SWISS 56->126 PANB_SYNJB 5e-04 32.9 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62683.1 GT:GENE AAL62683.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(160575..160967) GB:FROM 160575 GB:TO 160967 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62683.1 GB:DB_XREF GI:18159245 LENGTH 130 SQ:AASEQ MEKGLEEVRKIFISAYNGDALLYTHLFNVGEALSAIHKAARRAGKLEVYPLLKKRLLGDVRRLTRLGAMRLLPLTIGQVLEASKYVERHGLYIADALQIVSAIQTNSALITGDGRLCNAARLEGIECKFV GT:EXON 1|1-130:0| BL:SWS:NREP 1 BL:SWS:REP 56->126|PANB_SYNJB|5e-04|32.9|70/100| HM:PFM:NREP 1 HM:PFM:REP 20->126|PF01850|4.9e-07|23.2|95/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 6->121|2fe1A1|2e-05|20.0|110/130|c.120.1.1| HM:SCP:REP 1->116|1w8iA_|6.8e-07|26.2|103/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 7 OP:NHOMOORG 6 OP:PATTERN ----------------1-21--1---------------------------------1---1------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc //