[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62694.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.1.20
:305 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   39->224 1j2bA PDBj 8e-07 29.7 %
:RPS:SCOP  39->224 1iq8A1  c.1.20.1 * 1e-19 26.3 %
:HMM:SCOP  13->307 1iq8A1 c.1.20.1 * 9.6e-42 21.9 %
:HMM:PFM   65->218 PF01702 * TGT 1.7e-06 22.1 145/238  
:BLT:SWISS 24->226 Y306_SIRV1 9e-12 29.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62694.1 GT:GENE AAL62694.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(166449..167366) GB:FROM 166449 GB:TO 167366 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62694.1 GB:DB_XREF GI:18159256 LENGTH 305 SQ:AASEQ MKVVLGTPLNAVPRPWLYFHVPAVMVNALEVKRDPRSALGFEGELWIDSGGYQILKKGLTVDVDKIAEIYRRVDAQLYFSLDVPPSPSDPLEVAEKKFEKSYKNWERLRRALGDIVVPVLHVYREEGLFLKYLRKYSDAPALAIGGAVPYVLTTRGVPRGSRELALRLISIARREFKGPIHVLGMGSPSVTPILHAMGIQSTDSATWRLKAAYGKVILPGGGERHVTSRAVSFGKAKPKDGELEELYRFLMETGFPALDGFYERIRTSFEYRALVNAWVVVKSWSQTPRAPAFRKLYLQVAAARR GT:EXON 1|1-305:0| BL:SWS:NREP 1 BL:SWS:REP 24->226|Y306_SIRV1|9e-12|29.2|178/306| SEG 80->91|sldvppspsdpl| BL:PDB:NREP 1 BL:PDB:REP 39->224|1j2bA|8e-07|29.7|175/576| HM:PFM:NREP 1 HM:PFM:REP 65->218|PF01702|1.7e-06|22.1|145/238|TGT| RP:SCP:NREP 1 RP:SCP:REP 39->224|1iq8A1|1e-19|26.3|175/355|c.1.20.1| HM:SCP:REP 13->307|1iq8A1|9.6e-42|21.9|288/0|c.1.20.1|1/1|tRNA-guanine transglycosylase| OP:NHOMO 17 OP:NHOMOORG 16 OP:PATTERN ---2-1--11111111-111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 175 STR:RPRED 57.4 SQ:SECSTR ######################################HTcccEEEEEccHHHHHHccccccHHHHHHHHHHTTcccEEcccccccccccHHHHHHHHHHHHH###HHHHTTTTccccEEccc##ccTTcHHHHHHHHHHHHHEcccHHHHHTTc#####HHHHHHHHHHHHccTTc#cEEEETcccHHHHHHHHTTTccEEEEcHHHHHHHHTEEEETTEEEE################################################################################# PSIPRED ccEEccccccccHHHHHHccccEEEEEHHHHHccHHHHccccccEEEEccccEEEcccEEEcHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHccccHHHHHHHHHHccccEEEEccccEEEccccHHccccccccccHHHHHHHHHHHccccccccccHHcccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccc //