[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62703.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  4/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:61 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62703.1 GT:GENE AAL62703.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(171931..172116) GB:FROM 171931 GB:TO 172116 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62703.1 GB:DB_XREF GI:18159266 LENGTH 61 SQ:AASEQ MGILKVRVGVFNPKAPERTVETEAVVDAGAIYSVVRRDILEALVVQPIKGLRLLEAMWSGM GT:EXON 1|1-61:0| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN ------------------11-1------------------------------------------1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-39,45-45| PSIPRED ccEEEEEEEEEccccccHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //