[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62723.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:146 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  2->121 2fe1A1  c.120.1.1 * 6e-05 26.4 %
:HMM:SCOP  1->141 2fe1A1 c.120.1.1 * 3.6e-14 27.9 %
:HMM:PFM   2->140 PF01850 * PIN 1.1e-09 21.8 119/126  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62723.1 GT:GENE AAL62723.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 191049..191489 GB:FROM 191049 GB:TO 191489 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62723.1 GB:DB_XREF GI:18159288 LENGTH 146 SQ:AASEQ MIYLDTSALIKRYVKEADSDVVDGLFEAAYRGEVAVSTSVFNIGEAATAADKKARRGELSGDVRTAVSLMLREIAVLSSLGSLVIVPIGLSVMKASIHIALTHKLYIADALQIASCLRVKCHELYTADKALADAAEKEGIKTRVLR GT:EXON 1|1-146:0| TM:NTM 1 TM:REGION 70->92| SEG 127->138|adkaladaaeke| HM:PFM:NREP 1 HM:PFM:REP 2->140|PF01850|1.1e-09|21.8|119/126|PIN| RP:SCP:NREP 1 RP:SCP:REP 2->121|2fe1A1|6e-05|26.4|110/130|c.120.1.1| HM:SCP:REP 1->141|2fe1A1|3.6e-14|27.9|129/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 9 OP:NHOMOORG 7 OP:PATTERN -----1----------2-12--1---------------------------------1---1------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 146-147| PSIPRED cEEEEHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccEEEccHHHHHHHHHccccEEccc //