[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62735.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:95 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   41->86 PF04901 * RAMP 0.0005 26.1 46/115  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62735.1 GT:GENE AAL62735.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(199877..200164) GB:FROM 199877 GB:TO 200164 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62735.1 GB:DB_XREF GI:18159300 LENGTH 95 SQ:AASEQ MPVVLGFHRGATAPSRGAAIAAVVMIVIIFTTLALGIYSLELYLIAIHYQYFTNLIATIPYMRREPHVASAFIMASMIIMVLLNHLYSYMFFRQS GT:EXON 1|1-95:0| TM:NTM 2 TM:REGION 21->43| TM:REGION 65->87| SEG 18->29|aaiaavvmivii| HM:PFM:NREP 1 HM:PFM:REP 41->86|PF04901|0.0005|26.1|46/115|RAMP| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 25-25,53-53,59-59,62-62,67-67,73-73,76-76,81-81| PSIPRED ccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //