[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62738.1
DDBJ      :             P. aerophilum family 1964 protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:334 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   163->250 2osyB PDBj 2e-05 32.1 %
:RPS:PDB   14->74 2chgA PDBj 3e-04 23.0 %
:RPS:PDB   105->217 1a6dA PDBj 5e-05 19.1 %
:RPS:SCOP  5->70 1l8qA2  c.37.1.20 * 5e-06 29.2 %
:HMM:SCOP  2->251 2fnaA2 c.37.1.20 * 1.9e-07 23.4 %
:RPS:PFM   18->71 PF01637 * Arch_ATPase 3e-07 42.6 %
:HMM:PFM   15->223 PF01637 * Arch_ATPase 2.4e-62 34.6 208/234  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62738.1 GT:GENE AAL62738.1 GT:PRODUCT P. aerophilum family 1964 protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(202050..203054) GB:FROM 202050 GB:TO 203054 GB:DIRECTION - GB:PRODUCT P. aerophilum family 1964 protein GB:NOTE Hypothetical; Conserved within genome GB:PROTEIN_ID AAL62738.1 GB:DB_XREF GI:18159304 LENGTH 334 SQ:AASEQ MKKIRLSFANFQIEFADRDLALRRVEEWAERGMTVVHVVYGPEGCGKTAWLRQSAVLLRELCFHVIYVDALHRYFEAYTDVKEVAKKLAEAAAEAVDIAQLKLATLAIDLAKELIKRRKRKVAVLADDVFSAIGLDKAAIYVKGLLGLIEYPPGDYDAMITIATTSEGASRREIGRHRWAYLDAMWNMPRDGFKQLYDQLPGEKPPFDDVWKTTGGNPKLLGQLYEFGWDVEKLVQRLVEDRELASFSLLKWGSWLKTAVEDPDVLWSPDTPRELVEELIRKNLIIYNLHSRDPYFWIDVPPPEKDLGLCIGKHVAWQTPLHKEAVKRVLTQHD GT:EXON 1|1-334:0| SEG 81->96|vkevakklaeaaaeav| BL:PDB:NREP 1 BL:PDB:REP 163->250|2osyB|2e-05|32.1|84/435| RP:PDB:NREP 2 RP:PDB:REP 14->74|2chgA|3e-04|23.0|61/223| RP:PDB:REP 105->217|1a6dA|5e-05|19.1|110/503| RP:PFM:NREP 1 RP:PFM:REP 18->71|PF01637|3e-07|42.6|54/208|Arch_ATPase| HM:PFM:NREP 1 HM:PFM:REP 15->223|PF01637|2.4e-62|34.6|208/234|Arch_ATPase| GO:PFM:NREP 1 GO:PFM GO:0005524|"GO:ATP binding"|PF01637|IPR011579| RP:SCP:NREP 1 RP:SCP:REP 5->70|1l8qA2|5e-06|29.2|65/213|c.37.1.20| HM:SCP:REP 2->251|2fnaA2|1.9e-07|23.4|235/0|c.37.1.20|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 36 OP:NHOMOORG 8 OP:PATTERN -----1----------24A6913--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 204 STR:RPRED 61.1 SQ:SECSTR #############GccccHHHHHHHHHHHHTTccccEEEEccTTccHHHHHHHHHHHHHGGGGGGGEEEEETTc##############################HHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHcEEcccHHHHHHHHHHHccTTTcccccTHHGHHHHHHHHHHHHHcEEccccEEccGGGEEEEEcccccTHHH#HHHHHHH##HHHHHHHTTcTTEEEEEcc#################################################################################### DISOP:02AL 1-2, 332-334| PSIPRED ccEEEEEEEEEEEEEEcHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccEEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHcccHHHHHHHHHHHHcccccccEEEEEEEEEEccccHHHHHHHHHccccccccccccccHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccEEccccHHHHHHHHHHccHHEEEccccccEEEccccccccccccccccHHHHcccHHHHHHHHHHHccc //