[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62748.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y372_PYRAE   RecName: Full=UPF0284 protein PAE0372;

Homologs  Archaea  56/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.39.1
:338 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   51->218 1d0sA PDBj 1e-20 18.7 %
:RPS:SCOP  20->229 1d0sA  c.39.1.1 * 5e-29 20.6 %
:HMM:SCOP  21->328 1j33A_ c.39.1.1 * 1.9e-51 32.4 %
:HMM:PFM   64->237 PF02277 * DBI_PRT 2.7e-30 32.7 171/327  
:BLT:SWISS 1->338 Y372_PYRAE 0.0 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62748.1 GT:GENE AAL62748.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(212025..213041) GB:FROM 212025 GB:TO 213041 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62748.1 GB:DB_XREF GI:18159314 LENGTH 338 SQ:AASEQ MKLEPQIMAIVIGTTDISLIPGISVAGASPELTHYTPALDVEYLLLGMPKTMEVIPVTPEGIPTPALVTRAVAGEVAKLVVNAGSRITPKVPYVDLGGEPGRDFRRGPALSCEAARNILERGRALGCELGRLGCIYIGESIPGGTTTAMAILVAMGYDAWGRTSSASPNNPKELKIAVVKEGLRRVSAPLKPLEAVCEMGDPVHLAVAAIALGVSECGGVPVLAGGTQMAAAAALYKGLGGDLAKLHVATTRWIAEDKSADFMGLMEIVGVKNVYIAGVSFAGSKYEGLRAYERGAVKEGVAMGGALFYALSKGKDVLRLVEAEYERLLSAGVAGNVN GT:EXON 1|1-338:0| SW:ID Y372_PYRAE SW:DE RecName: Full=UPF0284 protein PAE0372; SW:GN OrderedLocusNames=PAE0372; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->338|Y372_PYRAE|0.0|100.0|338/338| SEG 230->246|aaaaalykglggdlakl| RP:PDB:NREP 1 RP:PDB:REP 51->218|1d0sA|1e-20|18.7|166/346| HM:PFM:NREP 1 HM:PFM:REP 64->237|PF02277|2.7e-30|32.7|171/327|DBI_PRT| RP:SCP:NREP 1 RP:SCP:REP 20->229|1d0sA|5e-29|20.6|209/346|c.39.1.1| HM:SCP:REP 21->328|1j33A_|1.9e-51|32.4|284/333|c.39.1.1|1/1|Nicotinate mononucleotide:5,6-dimethylbenzimidazole phosphoribosyltransferase (CobT)| OP:NHOMO 96 OP:NHOMOORG 95 OP:PATTERN 11----1111111111--1-1111111111--1111111111111111111111111111-111--11 ---------------------------------------------------------------1----------------------------------------------------------------------------------111111111111111-111111111111111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 166 STR:RPRED 49.1 SQ:SECSTR ##################################################HHHHHHHHHHTccHHHHHHHHTTcEEE##EEEEEccccccTTcEEccccccccTTTcccccHHHHHHHHHHHHHHHHHHHTTTEEEEEEEcTTTHHHHHHHHHHHHTHHHcccTTTccGGGHHHHHHHHHHHHHHHcccTTHHHHHHHHccHHHHHHHHHHHHHHHTT######################################################################################################################## DISOP:02AL 1-2, 337-338| PSIPRED ccccccEEEEEEEcccEEEcccEEEccccHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHcccEEEEEccccccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHHcccccccEEEEEEEEEEEccccHHHHHHHHHccccEEEcccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //