[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62759.1
DDBJ      :             conserved protein, degenerate
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62759.1 GT:GENE AAL62759.1 GT:PRODUCT conserved protein, degenerate GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 219654..219962 GB:FROM 219654 GB:TO 219962 GB:DIRECTION + GB:PRODUCT conserved protein, degenerate GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62759.1 GB:DB_XREF GI:18159326 LENGTH 102 SQ:AASEQ MCYIIEEVLEEVRSDKTVEFVAEGLARGFFAIYPFRRELEPLVREIIIISDPRIRRLEPPEAYAIAIGYKEGAVVLTEKRRTCFINMLTSLKTSKCGGATSS GT:EXON 1|1-102:0| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 99-102| PSIPRED cEEccHHHHHHcccccHHHHHHHHHHcccEEEccccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEHHHccEEEEcccHHHHHHHHHHHccccccccccc //