[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62790.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:261 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62790.1 GT:GENE AAL62790.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(237185..237970) GB:FROM 237185 GB:TO 237970 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62790.1 GB:DB_XREF GI:18159359 LENGTH 261 SQ:AASEQ MIALAVLGGLAAARRLGPGWGVLAMYLLYLAYGAHPLLFWAGLAGLLALGRGLFWDRQTALAFALAFGKFLLVPFLLGRLLPYYEALWYALRASPAWASYAPLTYLPQAPPLELALGGTLFVVSAAALGGRALAEVWGRGAVLWPLLATQPLWFGQWGMAAPLVWASAYFAAKGSWAGVLASLALASGLHIYGGILAAAAAFLWGARWVVLLAPALFLLPQSWILWALAGSLAGSDLASRVAFSSPRRPGGWLKPPWRGRC GT:EXON 1|1-261:0| TM:NTM 6 TM:REGION 25->47| TM:REGION 59->81| TM:REGION 112->134| TM:REGION 145->167| TM:REGION 179->201| TM:REGION 210->232| SEG 3->21|alavlgglaaarrlgpgwg| SEG 23->34|lamyllylayga| SEG 37->55|llfwaglagllalgrglfw| SEG 60->82|alafalafgkfllvpfllgrllp| SEG 174->189|gswagvlaslalasgl| SEG 197->201|aaaaa| SEG 209->220|vvllapalfllp| SEG 222->239|swilwalagslagsdlas| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN ------------------1--11--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-87,90-90,95-95,129-129,132-132,137-137,157-157,160-160,165-165,207-207,241-242,244-244,261-262| PSIPRED cHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEccEEEEEHHHHHcHHHHHHHHccccHHHHHHHcccccccccccccHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccccccccccccccccc //