[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62817.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:110 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   9->95 PF03748 * FliL 0.00032 19.4 62/149  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62817.1 GT:GENE AAL62817.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 261302..261634 GB:FROM 261302 GB:TO 261634 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62817.1 GB:DB_XREF GI:18159388 LENGTH 110 SQ:AASEQ MANWVLYVGIIVVVVVGALWLVLSKPGQAGEVVLKGRLAAVVTDYVNKTSRTDYFLQVVEDGKVRDVPLDLSNATIRLKDFFNNYIGTGREVYVRGYWRGDVFVALEVYD GT:EXON 1|1-110:0| TM:NTM 1 TM:REGION 6->28| SEG 4->23|wvlyvgiivvvvvgalwlvl| HM:PFM:NREP 1 HM:PFM:REP 9->95|PF03748|0.00032|19.4|62/149|FliL| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-31,39-39,53-53,67-67,81-81,87-88,90-90| PSIPRED cccEEEHHHHHHHHHHHHHHHHHcccccccEEEEEEEHHHHHHHHHccccccEEEEEEEEcccEEEEEEEccccEEEHHHHHHHHcccccEEEEEEEEcccEEEEEEEcc //