[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62837.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:405 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62837.1 GT:GENE AAL62837.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(277542..278759) GB:FROM 277542 GB:TO 278759 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62837.1 GB:DB_XREF GI:18159410 LENGTH 405 SQ:AASEQ MRNIIPLSVTPALEEICEEIERLGEPANPALGRMLERAYGVLKVGGAVAGHYGQGKSLTAALSALLEIFSGRPGVVLKVNQILLAGRRVRLSEVSNLAELTKASECEGYRKWFNKLDWVRDKGLSITKPKALGDIQLEIEGERLDRVYSAVRQLRERGFFIVVDEFERLVEQPHIYGYKDVIHLVEEFFNLVDRWGGAAGLAIPTSLWIHFDLQIKSRIAPIYYLHQDVTPEDMKKFLRNKLGGDVGEPLSYVEFRNPRVVMRIAKLLKGGEAPEKIVKDRASLLQKIAYFYRASDKTKKYLFIAYFASWLKQNIYNTLTETDINQAKGVLRVLGLLDAEIKVEELISKLSKRRKALMRKVPGGYILTAVAIAHLRDTLFEKDFQERALAAYGDFYELALELSLA GT:EXON 1|1-405:0| SEG 14->21|eeiceeie| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------1-1----------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHccccccccHHHHHHHHHHHHHcccccEEEEEHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccccccEEEEEcHHHHHHHHHHHHHHHHcccEEEEHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEEHHHcccEEEEEccccHHHHHHHHHHHHcccccccHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //