[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62909.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62909.1 GT:GENE AAL62909.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(341448..341759) GB:FROM 341448 GB:TO 341759 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62909.1 GB:DB_XREF GI:18159487 LENGTH 103 SQ:AASEQ MFVQYVRYSPVGEYLRLVIMQRLIKGPATVEEINGLAKKVVEGVGIKYDWRVWPELLRREILIKDGVVELTKEGRWIYEQTKEEVLEYVKRFLRTVTCCLDVS GT:EXON 1|1-103:0| OP:NHOMO 6 OP:NHOMOORG 5 OP:PATTERN ------------------12111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 87-88,90-90| PSIPRED ccEEEEEEcHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHEEcc //