[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62912.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  16/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1
:124 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  11->124 2dp9A1  b.122.1.5 * 8e-14 20.2 %
:HMM:SCOP  6->108 1te7A_ b.122.1.7 * 2.5e-22 34.3 %
:HMM:PFM   12->108 PF04266 * ASCH 4.7e-14 25.0 96/104  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62912.1 GT:GENE AAL62912.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(343729..344103) GB:FROM 343729 GB:TO 344103 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62912.1 GB:DB_XREF GI:18159490 LENGTH 124 SQ:AASEQ MGRYVELGPYLRFKRKYLEGILDGKKRVTVRYGIVRPRFSLVYIVCCDHIYGEAIITKVYYTRLEKVGQDVIEAEGFGSREELVSELKEIYGEVRDGDTVSVIFFSLVRKYDKPVPLARLGEGV GT:EXON 1|1-124:0| HM:PFM:NREP 1 HM:PFM:REP 12->108|PF04266|4.7e-14|25.0|96/104|ASCH| RP:SCP:NREP 1 RP:SCP:REP 11->124|2dp9A1|8e-14|20.2|104/120|b.122.1.5| HM:SCP:REP 6->108|1te7A_|2.5e-22|34.3|99/0|b.122.1.7|1/1|PUA domain-like| OP:NHOMO 23 OP:NHOMOORG 16 OP:PATTERN -1-111----------2-22212------------------------------1-1-122-----1-- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED cccEEEEcccEEEcHHHHHHHHcccEEEEEEcccccccccEEEEEEccEEEEEEEEEEEEEEEEEEccHHHHHHcccccHHHHHHHHHHHccccccccEEEEEEEEEEEcccccccHHHHcccc //