[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62942.1
DDBJ      :             ribosomal protein L13
Swiss-Prot:RL13_PYRAE   RecName: Full=50S ribosomal protein L13P;

Homologs  Archaea  68/68 : Bacteria  20/915 : Eukaryota  177/199 : Viruses  0/175   --->[See Alignment]
c.21.1
:187 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   19->162 1s1iM PDBj 7e-20 44.8 %
:RPS:PDB   19->136 3d5bN PDBj 1e-18 33.9 %
:RPS:SCOP  19->158 1j3aA  c.21.1.1 * 3e-23 40.8 %
:HMM:SCOP  18->166 1j3aA_ c.21.1.1 * 5.1e-31 40.8 %
:RPS:PFM   20->121 PF00572 * Ribosomal_L13 1e-10 50.0 %
:HMM:PFM   19->130 PF00572 * Ribosomal_L13 9e-30 39.4 109/128  
:BLT:SWISS 1->187 RL13_PYRAE e-106 100.0 %
:PROS 100->123|PS00783|RIBOSOMAL_L13

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62942.1 GT:GENE AAL62942.1 GT:PRODUCT ribosomal protein L13 GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 369192..369755 GB:FROM 369192 GB:TO 369755 GB:DIRECTION + GB:PRODUCT ribosomal protein L13 GB:NOTE Protein synthesis; Ribosomal proteins: synthesis and modification GB:PROTEIN_ID AAL62942.1 GB:DB_XREF GI:18159523 LENGTH 187 SQ:AASEQ MNVVKRPLDISQLPDAGEVIVDAEGHVAGRLATYIAKALLERPNLRIVVVNAEKLVITGDEKMVIEWFKRKISEWRTHYNPEKAGPKVPRRPDRVFKRIVRGMLPKKSETGRSALKRLRVYMSIPIEIMQRKRLVLYEVPEAKLRLRPLLQYTTLEEVWRSIDPEAWEKWRRAVEVWGKKLKQVASG GT:EXON 1|1-187:0| SW:ID RL13_PYRAE SW:DE RecName: Full=50S ribosomal protein L13P; SW:GN Name=rpl13p; OrderedLocusNames=PAE0673; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->187|RL13_PYRAE|e-106|100.0|187/187| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| PROS 100->123|PS00783|RIBOSOMAL_L13|PDOC00625| BL:PDB:NREP 1 BL:PDB:REP 19->162|1s1iM|7e-20|44.8|134/146| RP:PDB:NREP 1 RP:PDB:REP 19->136|3d5bN|1e-18|33.9|115/137| RP:PFM:NREP 1 RP:PFM:REP 20->121|PF00572|1e-10|50.0|94/128|Ribosomal_L13| HM:PFM:NREP 1 HM:PFM:REP 19->130|PF00572|9e-30|39.4|109/128|Ribosomal_L13| GO:PFM:NREP 4 GO:PFM GO:0003735|"GO:structural constituent of ribosome"|PF00572|IPR005822| GO:PFM GO:0005622|"GO:intracellular"|PF00572|IPR005822| GO:PFM GO:0005840|"GO:ribosome"|PF00572|IPR005822| GO:PFM GO:0006412|"GO:translation"|PF00572|IPR005822| RP:SCP:NREP 1 RP:SCP:REP 19->158|1j3aA|3e-23|40.8|120/129|c.21.1.1| HM:SCP:REP 18->166|1j3aA_|5.1e-31|40.8|142/142|c.21.1.1|1/1|Ribosomal protein L13| OP:NHOMO 347 OP:NHOMOORG 265 OP:PATTERN 11111111111111111111111111111111111111111111111111111111111111111111 ---1--------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------1---------------------------11--111111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111---------------------------------------------------1-111--- 1111111-522111211111111111111111111111111111111111111111111111111111-111111-2--111111123-11111111111111243-1212121111112-12121-313D3-321-1--2-112111--1--1---11111111111-1111111111I1111152531421111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 145 STR:RPRED 77.5 SQ:SECSTR #################cEEEccTTccHHHHHHHHHHHHTGGGcTcEEEcccTTccccccTTTTcccEEEcccccTTcccEEEHHHHHHccTHHHHHHHHHHHccccHcHHHHHHHTEEEcccccccccccccEEcGGTTcccccccccccccccTTHHHHc######################### DISOP:02AL 1-4, 186-187| PSIPRED cccccccccccccccccEEEEEccccEEHHHHHHHHHHHHcccccEEEEEEccEEEEEccHHHHHHHHHHHHcccccccccccHHHHHcccHHHHHHHHHHHccccccHHHHHHHHccEEccccccHHHccccEEccHHHHHHHcccccccEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //