[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62944.1
DDBJ      :             DNA-directed RNA polymerase subunit N (rpoN)
Swiss-Prot:RPON_PYRAE   RecName: Full=DNA-directed RNA polymerase subunit N;         EC=2.7.7.6;

Homologs  Archaea  66/68 : Bacteria  0/915 : Eukaryota  135/199 : Viruses  0/175   --->[See Alignment]
a.4.11
:66 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->64 2pmzN PDBj 3e-19 59.4 %
:RPS:PDB   2->54 1ef4A PDBj 1e-18 56.6 %
:RPS:SCOP  1->62 1i3qJ  a.4.11.1 * 5e-21 41.9 %
:HMM:SCOP  1->64 1i50J_ a.4.11.1 * 7.4e-24 53.1 %
:RPS:PFM   1->60 PF01194 * RNA_pol_N 3e-13 51.7 %
:HMM:PFM   1->60 PF01194 * RNA_pol_N 1.1e-30 53.3 60/60  
:BLT:SWISS 1->66 RPON_PYRAE 3e-37 100.0 %
:PROS 2->11|PS01112|RNA_POL_N_8KD

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62944.1 GT:GENE AAL62944.1 GT:PRODUCT DNA-directed RNA polymerase subunit N (rpoN) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 370195..370395 GB:FROM 370195 GB:TO 370395 GB:DIRECTION + GB:PRODUCT DNA-directed RNA polymerase subunit N (rpoN) GB:NOTE Transcription; DNA-dependent RNA polymerase GB:PROTEIN_ID AAL62944.1 GB:DB_XREF GI:18159525 LENGTH 66 SQ:AASEQ MIIPIRCFTCGKPLGHLYAVFKRRVLAGEHPGRVLDDLGVTRYCCRRTLMAHVEWIDDVLLYERRS GT:EXON 1|1-66:0| SW:ID RPON_PYRAE SW:DE RecName: Full=DNA-directed RNA polymerase subunit N; EC=2.7.7.6; SW:GN Name=rpoN; OrderedLocusNames=PAE0675; ORFNames=PAE0675A; SW:KW Complete proteome; DNA-directed RNA polymerase; Metal-binding;Nucleotidyltransferase; Transcription; Transferase; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->66|RPON_PYRAE|3e-37|100.0|66/66| GO:SWS:NREP 5 GO:SWS GO:0003899|"GO:DNA-directed RNA polymerase activity"|DNA-directed RNA polymerase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 2->11|PS01112|RNA_POL_N_8KD|PDOC00856| BL:PDB:NREP 1 BL:PDB:REP 1->64|2pmzN|3e-19|59.4|64/64| RP:PDB:NREP 1 RP:PDB:REP 2->54|1ef4A|1e-18|56.6|53/55| RP:PFM:NREP 1 RP:PFM:REP 1->60|PF01194|3e-13|51.7|60/60|RNA_pol_N| HM:PFM:NREP 1 HM:PFM:REP 1->60|PF01194|1.1e-30|53.3|60/60|RNA_pol_N| GO:PFM:NREP 3 GO:PFM GO:0003677|"GO:DNA binding"|PF01194|IPR000268| GO:PFM GO:0003899|"GO:DNA-directed RNA polymerase activity"|PF01194|IPR000268| GO:PFM GO:0006351|"GO:transcription, DNA-dependent"|PF01194|IPR000268| RP:SCP:NREP 1 RP:SCP:REP 1->62|1i3qJ|5e-21|41.9|62/65|a.4.11.1| HM:SCP:REP 1->64|1i50J_|7.4e-24|53.1|64/0|a.4.11.1|1/1|RNA polymerase subunit RPB10| OP:NHOMO 226 OP:NHOMOORG 201 OP:PATTERN 11111111111111111111111111111-1111111-111111111111111111111111111111 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- 11-111-11-11-1-11---111----11----111--111-11111-11-1-1112111111--111--11-1-111111---1-11--211-1111111-1112111-2--1-1-1-1-21-12-11131-11-------111-1--1----1211211131111111--11111117111111232121111-1-1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 64 STR:RPRED 97.0 SQ:SECSTR cccccccccTTcccHHHHHHHHHHHHHTccHHHHHHHHTcccHHHHHHHTTTccTHHHHcTTcc## DISOP:02AL 64-66| PSIPRED ccccccccccccccccHHHHHHHHHHccccHHHHHHHHccEEHHHHHHHHHHHHHHHHHHcccccc //