[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62986.1
DDBJ      :             transcriptional regulatory protein, conjectural
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:78 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->60 2h09A PDBj 4e-06 43.5 %
:RPS:PDB   7->44 3cwrB PDBj 3e-04 15.8 %
:RPS:PDB   17->59 1biaA PDBj 2e-08 23.3 %
:RPS:SCOP  15->61 1lvaA4  a.4.5.35 * 3e-07 23.4 %
:HMM:SCOP  9->78 1xmkA1 a.4.5.19 * 1e-10 40.6 %
:RPS:PFM   15->62 PF01325 * Fe_dep_repress 9e-06 41.7 %
:HMM:PFM   17->59 PF01022 * HTH_5 2.9e-08 40.5 42/47  
:BLT:SWISS 15->60 MNTR_ECOLI 1e-05 43.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62986.1 GT:GENE AAL62986.1 GT:PRODUCT transcriptional regulatory protein, conjectural GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 406222..406458 GB:FROM 406222 GB:TO 406458 GB:DIRECTION + GB:PRODUCT transcriptional regulatory protein, conjectural GB:NOTE Regulatory functions; General GB:PROTEIN_ID AAL62986.1 GB:DB_XREF GI:18159570 LENGTH 78 SQ:AASEQ MVNHAVRDLTSQRLVEQIINLLKEYGELSSADIAKMLGVNRRSVAAILARLRREGIVEYIGYCFGGNRCNTKWKLKMN GT:EXON 1|1-78:0| BL:SWS:NREP 1 BL:SWS:REP 15->60|MNTR_ECOLI|1e-05|43.5|46/155| BL:PDB:NREP 1 BL:PDB:REP 15->60|2h09A|4e-06|43.5|46/127| RP:PDB:NREP 2 RP:PDB:REP 7->44|3cwrB|3e-04|15.8|38/187| RP:PDB:REP 17->59|1biaA|2e-08|23.3|43/292| RP:PFM:NREP 1 RP:PFM:REP 15->62|PF01325|9e-06|41.7|48/59|Fe_dep_repress| HM:PFM:NREP 1 HM:PFM:REP 17->59|PF01022|2.9e-08|40.5|42/47|HTH_5| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01325|IPR001367| GO:PFM GO:0005506|"GO:iron ion binding"|PF01325|IPR001367| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01325|IPR001367| RP:SCP:NREP 1 RP:SCP:REP 15->61|1lvaA4|3e-07|23.4|47/60|a.4.5.35| HM:SCP:REP 9->78|1xmkA1|1e-10|40.6|64/0|a.4.5.19|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 69 STR:RPRED 88.5 SQ:SECSTR ####TccHHHHHHHHHHHHHHHTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcccEccccccGGGGTccE##### DISOP:02AL 1-3| PSIPRED ccccHHHccHHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccHHHHHHcccccccccEEEEEcc //