[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62991.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.308.1
:98 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->98 1rkiA PDBj 1e-46 100.0 %
:RPS:SCOP  18->98 1rkiA1  d.308.1.2 * 1e-37 100.0 %
:HMM:SCOP  1->98 1rkiA1 d.308.1.2 * 9.1e-51 68.4 %
:RPS:PFM   18->92 PF11424 * DUF3195 6e-24 66.7 %
:HMM:PFM   4->92 PF11424 * DUF3195 9.5e-52 70.8 89/89  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62991.1 GT:GENE AAL62991.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 409722..410018 GB:FROM 409722 GB:TO 410018 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL62991.1 GB:DB_XREF GI:18159575 LENGTH 98 SQ:AASEQ MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVN GT:EXON 1|1-98:0| SEG 2->17|kkhiiiktipkkeeii| BL:PDB:NREP 1 BL:PDB:REP 18->98|1rkiA|1e-46|100.0|81/101| RP:PFM:NREP 1 RP:PFM:REP 18->92|PF11424|6e-24|66.7|75/89|DUF3195| HM:PFM:NREP 1 HM:PFM:REP 4->92|PF11424|9.5e-52|70.8|89/89|DUF3195| RP:SCP:NREP 1 RP:SCP:REP 18->98|1rkiA1|1e-37|100.0|81/98|d.308.1.2| HM:SCP:REP 1->98|1rkiA1|9.1e-51|68.4|98/0|d.308.1.2|1/1|THUMP domain-like| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 81 STR:RPRED 82.7 SQ:SECSTR #################HHHHHHHHTTTcTTcEEEEEETTEEEEEEcHHHHHHHHTcHHHHTTEEEEEEEcEEEccccccccEEEEEETTEEEEEEcT DISOP:02AL 1-2| PSIPRED ccccEEEEEcccHHHHHHHHHHHHHHHccccEEEEcccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEcc //