[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL62999.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:Y745_PYRAE   RecName: Full=Protein PAE0745;

Homologs  Archaea  65/68 : Bacteria  84/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.309.1
:213 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->204 1vajA PDBj 1e-45 49.5 %
:RPS:SCOP  6->204 1vajA1  d.309.1.1 * 9e-32 47.2 %
:HMM:SCOP  1->215 1wscA1 d.309.1.1 * 3e-62 43.3 %
:RPS:PFM   13->190 PF01871 * AMMECR1 7e-26 40.6 %
:HMM:PFM   13->192 PF01871 * AMMECR1 1.8e-57 48.3 172/172  
:BLT:SWISS 1->213 Y745_PYRAE e-126 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL62999.1 GT:GENE AAL62999.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 415095..415736 GB:FROM 415095 GB:TO 415736 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL62999.1 GB:DB_XREF GI:18159584 LENGTH 213 SQ:AASEQ MFRPYSLEEGTFLVRLARAVVEKYLTTGRIEVPESVFPKLLSDNYGVFTTIESIHGDKYELRGCIGYPEGYRNTLYATVFSAIGACCQDPRFPALRREELASVIFEVSILSPLNLLEVDPRKYPEIIEVGRHGLVVKRGPYSGLLLPQVPVEECWSPEEFLMHTCIKAWLPGDCWLDKKTKLYIYEAQIFREKSPGGEVYERDLVSEFARCQR GT:EXON 1|1-213:0| SW:ID Y745_PYRAE SW:DE RecName: Full=Protein PAE0745; SW:GN OrderedLocusNames=PAE0745; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->213|Y745_PYRAE|e-126|100.0|213/213| BL:PDB:NREP 1 BL:PDB:REP 8->204|1vajA|1e-45|49.5|194/201| RP:PFM:NREP 1 RP:PFM:REP 13->190|PF01871|7e-26|40.6|170/172|AMMECR1| HM:PFM:NREP 1 HM:PFM:REP 13->192|PF01871|1.8e-57|48.3|172/172|AMMECR1| RP:SCP:NREP 1 RP:SCP:REP 6->204|1vajA1|9e-32|47.2|199/203|d.309.1.1| HM:SCP:REP 1->215|1wscA1|3e-62|43.3|215/0|d.309.1.1|1/1|AMMECR1-like| OP:NHOMO 154 OP:NHOMOORG 150 OP:PATTERN 111111111111111112111111-11-111-111111111111111111111111111111111111 -1------------------------------------------------------------------------------1--11111-----------------------------------------------------111--------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------1---1------------11------1---------111-211111111---1-----------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------1-------------------111-111111111-1111111111111--12--------------------1-11111----------1------------1----1------11--------------------------------------------------------------------------------------------------111-1-1-----------------------------------------------------------1--------------------------1-------------------------------------------11-111-111--- --------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 92.5 SQ:SECSTR #######HHHHHHHHHHHHHHHHHHHHccccccTTccGGGGccEEEEEEEEEETTcGGGTEEEEEEEccccccHHHHHHHHHHHHHHccTTcccccGGGHGGEEEEEEEEcccEEccccGGGGGGGccTTTcEEEEEETTEEEEEcTHHHHHHTccHHHHHHHHHHHTTccTTGGGcTTcEEEEEcEEEEEEccTTccEEEccc######### DISOP:02AL 1-3| PSIPRED ccccccccHHHHHHHHHHHHHHHHHcccccccccccccHHHcccccEEEEEEEEcccccEEEEEEccccccHHHHHHHHHHHHHHHccccccccccHHHcccEEEEEEEccccEEccccccccHHHcEEEEEEEEEEEccEEEEEcccccccccccHHHHHHHHHHHcccccccccccccEEEEEEEEEEEEEcccccccHHHHHHHHHHHcc //