[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63014.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  40/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:371 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   5->321 PF05559 * DUF763 6e-87 52.4 %
:HMM:PFM   5->321 PF05559 * DUF763 2.3e-131 53.4 313/319  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63014.1 GT:GENE AAL63014.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 426817..427932 GB:FROM 426817 GB:TO 427932 GB:DIRECTION + GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63014.1 GB:DB_XREF GI:18159600 LENGTH 371 SQ:AASEQ MKLSGIADLPLHDGHVPYWLLARMKKLSSLILRIMYELYGPDGIVDRFAHPVFFQAFNNVIGMDWDSSGSTTVTTAVVKEALWKSDIPVKVAGGKGRHALNTPKELMEIARLFDLDANELVVKSRLAAKVDGALLQDGYELYHHAFIVSETGKWGVIQQGLNPDLKMARRYHWLSTEDFFNSPHAGVVGIRHEKVLNLASKNSKDNRAVILELINEGASKVARYLYLLRGQATLFETPYYHPYIKLDIDIKAVVKNLPPPKSVADFKELLLQYRIGPKTLRALSLVAELIFKTPADWNDPAVDPFKFAFAVGGKDGVPSPIDKRVYDELITLLDAVVEKARGDPGLYRYLSHLAKKAESWKYPSDKKRPTL GT:EXON 1|1-371:0| SEG 67->78|ssgsttvttavv| RP:PFM:NREP 1 RP:PFM:REP 5->321|PF05559|6e-87|52.4|313/319|DUF763| HM:PFM:NREP 1 HM:PFM:REP 5->321|PF05559|2.3e-131|53.4|313/319|DUF763| OP:NHOMO 74 OP:NHOMOORG 73 OP:PATTERN 111111111111111111111111--------112-------------1----111111111111--- --1--------------------------------------------------------------------------------------------------1---11---------------------------------------------------------------------------------11------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1---1--------1----------11111----1------------------------1------11111111----------------------------------------------------------------------1--------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111---------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 370-371| PSIPRED cccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccEEEEEccccHHHHccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccEEEEEcccccccccccEEEEcccccccccccccccccccccEEEccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccccccc //