[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63017.1
DDBJ      :             N-acyltransferase
Swiss-Prot:             

Homologs  Archaea  64/68 : Bacteria  110/915 : Eukaryota  189/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:176 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->158 1yr0A PDBj 3e-09 38.5 %
:RPS:PDB   24->176 1b6bA PDBj 2e-24 18.9 %
:RPS:SCOP  24->176 1b6bA  d.108.1.1 * 1e-24 18.9 %
:HMM:SCOP  21->176 2b5gA1 d.108.1.1 * 4.6e-37 36.9 %
:RPS:PFM   97->153 PF00583 * Acetyltransf_1 5e-05 41.1 %
:HMM:PFM   66->154 PF00583 * Acetyltransf_1 1e-21 35.8 81/83  
:BLT:SWISS 16->176 Y258_SULTO 4e-51 60.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63017.1 GT:GENE AAL63017.1 GT:PRODUCT N-acyltransferase GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 429489..430019 GB:FROM 429489 GB:TO 430019 GB:DIRECTION + GB:PRODUCT N-acyltransferase GB:NOTE Protein fate; Protein modification and repair GB:PROTEIN_ID AAL63017.1 GB:DB_XREF GI:18159603 LENGTH 176 SQ:AASEQ MTLEIRIDGPQRLLGKDGKTEFIIREATLKDLNDIISINRKVLPENYPNWFFVEHLEQFPKAFIVAEIEGKVVGYVMSRVEYGWSNIHRGKAVRKGHIVSVGVLPEARRLGIATAMMLRAMKAMKVYYGASEVYLEVRVSNTPAISLYEKLGYKVVGRIPRYYSDGEDAFLMACPL GT:EXON 1|1-176:0| BL:SWS:NREP 1 BL:SWS:REP 16->176|Y258_SULTO|4e-51|60.0|160/167| BL:PDB:NREP 1 BL:PDB:REP 24->158|1yr0A|3e-09|38.5|122/160| RP:PDB:NREP 1 RP:PDB:REP 24->176|1b6bA|2e-24|18.9|148/168| RP:PFM:NREP 1 RP:PFM:REP 97->153|PF00583|5e-05|41.1|56/80|Acetyltransf_1| HM:PFM:NREP 1 HM:PFM:REP 66->154|PF00583|1e-21|35.8|81/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0008080|"GO:N-acetyltransferase activity"|PF00583|IPR000182| GO:PFM GO:0008152|"GO:metabolic process"|PF00583|IPR000182| RP:SCP:NREP 1 RP:SCP:REP 24->176|1b6bA|1e-24|18.9|148/168|d.108.1.1| HM:SCP:REP 21->176|2b5gA1|4.6e-37|36.9|149/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 755 OP:NHOMOORG 363 OP:PATTERN 111211222222221222212221111-111111111-222211111111-11111111111211-11 111----------------------1--------------------------1--1------------------------111-1---------------------------------------------------1---1----1--------------------1--1---------------------11-11111---1111--1--111-11-111--11------11----------------------------------------11-111--------------------------------------------------------1-11--------11--11-1111-1-1111-11111---1-----------1---------------------1----------1-----------------1-----------------------------------------------------------1------------------------------------1---------------------1----------------------1-------1-1111111111-11---------------------1------11-------1-------------------------1---------1-------------------------------------11----------------------------------------------------------1---------------------------------------------------------------1---11111111111------1--------------------------------------------1----------- 3122332-5132332322-233312122212223332322333333113234333322222222111321222221112123322232-33322351111133423-2325333333-322-31B5163CM5-538144131233131-23--43223233134331B54433433222N2222343673433333333 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 170 STR:RPRED 96.6 SQ:SECSTR ######cTTEEEEEEEEEEcTcEEEcccHHHHHHHHTcccccccccccccTTTTHHHHcGGGEEEEEETTEEEEEEEEEEEccccccTGGGGcccEEEEEEEEGGGcTTccHHHHHHHHHHHHHHTcTTccEccEEEEEEcGGGHHHHHTTTcEEEEEEccccEETTEEcEEEEEc DISOP:02AL 176-177| PSIPRED cEEEEEEcccHHHccccccccEEEEEccHHHHHHHHHHHHHHccccccHHHHHHHHHccccEEEEEEEccEEEEEEEEEEccccccccccccccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHcccEEEEEEEccccccccEEEEEccc //