[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63026.1
DDBJ      :             conserved protein with predicted RNA binding PUA domain
Swiss-Prot:             

Homologs  Archaea  36/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.122.1c.3.1d.17.6
:163 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->153 1j2bA PDBj 6e-15 35.6 %
:RPS:PDB   16->154 3d79A PDBj 1e-14 22.3 %
:RPS:SCOP  39->96 1cf3A1  c.3.1.2 * 9e-04 10.3 %
:RPS:SCOP  81->151 1sqwA1  b.122.1.1 * 1e-11 12.7 %
:HMM:SCOP  16->84 1iq8A4 d.17.6.1 * 1.5e-13 32.8 %
:HMM:SCOP  78->161 2apoA1 b.122.1.1 * 7.2e-14 31.0 %
:HMM:PFM   81->151 PF01472 * PUA 5.4e-17 35.2 71/74  
:HMM:PFM   27->69 PF06236 * MelC1 0.00021 37.2 43/125  
:BLT:SWISS 17->153 ATGT_METM7 9e-16 33.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63026.1 GT:GENE AAL63026.1 GT:PRODUCT conserved protein with predicted RNA binding PUA domain GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 438301..438792 GB:FROM 438301 GB:TO 438792 GB:DIRECTION + GB:PRODUCT conserved protein with predicted RNA binding PUA domain GB:NOTE Unclassified GB:PROTEIN_ID AAL63026.1 GB:DB_XREF GI:18159613 LENGTH 163 SQ:AASEQ MKRHIKTFVFFSVALNVVQIIAYLYGREVAERLAGRKINIKYNKEGRIRYVYVDGELAFVMRNNDGYLLPTLYGATLLDRRVVISREAAEYVKQGRNVPAKYVIEAAPHARPNGEVAVVDPEGLIVAVGRLIYSKKEITLKRGYAIKVRESLKDVKGQRALPQ GT:EXON 1|1-163:0| BL:SWS:NREP 1 BL:SWS:REP 17->153|ATGT_METM7|9e-16|33.6|137/649| TM:NTM 1 TM:REGION 5->27| BL:PDB:NREP 1 BL:PDB:REP 17->153|1j2bA|6e-15|35.6|135/576| RP:PDB:NREP 1 RP:PDB:REP 16->154|3d79A|1e-14|22.3|139/167| HM:PFM:NREP 2 HM:PFM:REP 81->151|PF01472|5.4e-17|35.2|71/74|PUA| HM:PFM:REP 27->69|PF06236|0.00021|37.2|43/125|MelC1| RP:SCP:NREP 2 RP:SCP:REP 39->96|1cf3A1|9e-04|10.3|58/385|c.3.1.2| RP:SCP:REP 81->151|1sqwA1|1e-11|12.7|71/76|b.122.1.1| HM:SCP:REP 16->84|1iq8A4|1.5e-13|32.8|67/0|d.17.6.1|1/1|Pre-PUA domain| HM:SCP:REP 78->161|2apoA1|7.2e-14|31.0|84/0|b.122.1.1|1/1|PUA domain-like| OP:NHOMO 37 OP:NHOMOORG 36 OP:PATTERN ---------------11111111--------1-1111111111-11--1111111111111--1---1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 148 STR:RPRED 90.8 SQ:SECSTR ######cEEEEcGGGHHHHHHHHHHcHHHHHHHccTTccEEEEEEETTEEEEEETTEEEEEEETTEEEHTTTccGGGcTTEEEEcGGGHHHHHTTccEEGGGEEEEcTTccTTcEEEEEETTccEEEEEEEcccHHHHHccccEEEEEEEETTc######### DISOP:02AL 1-3, 157-163| PSIPRED ccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccEEEEEEccccEEEEEEccEEEEEEEccccEEEEEHHHHHHHcccEEEEccHHHHHcccccEEEccEEEcccccccccEEEEEcccccEEEEEEEEEcHHHHHHccccEEEEccccccccHHccccc //