[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63035.1
DDBJ      :             molybdenum cofactor biosynthesis protein (moaC)
Swiss-Prot:MOAC_PYRAE   RecName: Full=Probable molybdenum cofactor biosynthesis protein C;

Homologs  Archaea  34/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.21
:244 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   125->243 2ohdF PDBj 4e-18 44.9 %
:RPS:PDB   3->103 2eeyA PDBj 4e-10 23.8 %
:RPS:PDB   127->228 2eeyA PDBj 4e-08 22.7 %
:HMM:SCOP  1->110 1ekrA_ d.58.21.1 * 3.8e-11 27.1 %
:HMM:SCOP  132->234 1ekrA_ d.58.21.1 * 5.2e-12 32.0 %
:RPS:PFM   127->227 PF01967 * MoaC 1e-04 34.0 %
:HMM:PFM   33->86 PF01967 * MoaC 0.00023 31.5 54/136  
:HMM:PFM   135->228 PF01967 * MoaC 8.5e-12 30.1 93/136  
:BLT:SWISS 1->244 MOAC_PYRAE e-124 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63035.1 GT:GENE AAL63035.1 GT:PRODUCT molybdenum cofactor biosynthesis protein (moaC) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(444998..445732) GB:FROM 444998 GB:TO 445732 GB:DIRECTION - GB:PRODUCT molybdenum cofactor biosynthesis protein (moaC) GB:NOTE Biosynthesis of cofactors, prosthetic groups, and carriers; Molybdopterin GB:PROTEIN_ID AAL63035.1 GB:DB_XREF GI:18159623 LENGTH 244 SQ:AASEQ MIVDISKKPDVFRYARASANADVKKCNTAVAAKAATVASRYLPFLHPLPLSATAWCKDGKFYVEGIAHWQTGVEMDVLFGVLVGLLGSGAVKIENLRVEIKQKQTTPPIIENVNTSEAPITREGDLVASAYGRMKVVNLDIVKNPVEKGHPIYAAQTAAALNAKRLCELLGGPCPSVQHFKIEIITSDSVEVRTFIKARDITPAPEALFSAGVALLTIWDMIKKYEKDENGQYPYTYISELHLD GT:EXON 1|1-244:0| SW:ID MOAC_PYRAE SW:DE RecName: Full=Probable molybdenum cofactor biosynthesis protein C; SW:GN Name=moaC; OrderedLocusNames=PAE0799; SW:KW Complete proteome; Molybdenum cofactor biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->244|MOAC_PYRAE|e-124|100.0|244/244| GO:SWS:NREP 1 GO:SWS GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|Molybdenum cofactor biosynthesis| SEG 28->38|tavaakaatva| SEG 77->91|vlfgvlvgllgsgav| BL:PDB:NREP 1 BL:PDB:REP 125->243|2ohdF|4e-18|44.9|118/144| RP:PDB:NREP 2 RP:PDB:REP 3->103|2eeyA|4e-10|23.8|101/160| RP:PDB:REP 127->228|2eeyA|4e-08|22.7|102/160| RP:PFM:NREP 1 RP:PFM:REP 127->227|PF01967|1e-04|34.0|100/136|MoaC| HM:PFM:NREP 2 HM:PFM:REP 33->86|PF01967|0.00023|31.5|54/136|MoaC| HM:PFM:REP 135->228|PF01967|8.5e-12|30.1|93/136|MoaC| GO:PFM:NREP 1 GO:PFM GO:0006777|"GO:Mo-molybdopterin cofactor biosynthetic process"|PF01967|IPR002820| HM:SCP:REP 1->110|1ekrA_|3.8e-11|27.1|107/0|d.58.21.1|1/2|Molybdenum cofactor biosynthesis protein C, MoaC| HM:SCP:REP 132->234|1ekrA_|5.2e-12|32.0|100/0|d.58.21.1|2/2|Molybdenum cofactor biosynthesis protein C, MoaC| OP:NHOMO 34 OP:NHOMOORG 34 OP:PATTERN --11-11111111111-1111111----------11--------1----11---11111111--1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 225 STR:RPRED 92.2 SQ:SECSTR ##ccccccccEEEEEEEEEccccccccHHHHHHHHHHHHHHcTTcccccccEEEEEcccccEEEEEEEEccccHHHHHHHHHHHTTTccccEEcccEEEEEEc################cccccEEEEEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHTccccccEEEEEEEEEccEEEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHTTTcccTTccccccEEcccEE# DISOP:02AL 1-6| PSIPRED cEEEccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEccccEEEEEEEHHHcccHHHHHHHHHHHHHccccEEEEEEEEEEEEccccccEEEEEEccccccEEEEEEEEEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHcccccccccEEEEEEEccccEEEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEEc //