[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63045.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:64 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->56 PF10644 * Misat_Myo_SegII 6.9e-05 25.0 40/101  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63045.1 GT:GENE AAL63045.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 450855..451049 GB:FROM 450855 GB:TO 451049 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63045.1 GB:DB_XREF GI:18159634 LENGTH 64 SQ:AASEQ MPRRHAVEAVEIARVFSPEEEYFVISYLKTNGTQPHDLAFYPGIGPQGDHSYFPLYTCLKIKEL GT:EXON 1|1-64:0| HM:PFM:NREP 1 HM:PFM:REP 17->56|PF10644|6.9e-05|25.0|40/101|Misat_Myo_SegII| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5| PSIPRED ccccHHHHHHHHHHHccccccEEEEEEEEccccccccEEEEcccccccccccccEEEEEEEEcc //