[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63069.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  6/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.185.1
:243 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  76->183 1hr6A2  d.185.1.1 * 1e-04 14.6 %
:BLT:SWISS 74->189 CEP63_CHICK 3e-04 26.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63069.1 GT:GENE AAL63069.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 483565..484296 GB:FROM 483565 GB:TO 484296 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63069.1 GB:DB_XREF GI:18159660 LENGTH 243 SQ:AASEQ MSVCPALRRGEGGFVCGYTSKPIDPFSWYCIGNYTECPIFIRYTREEKTRAALPSKPEEAPKPLAEVLPLAPESAEAEFEKAIKPVIDNIVLKYDDLVKKLDNMWKEYEGDVVKIRRQWEVEKMSLLRAQEILNRTIGDYEKMLSGLELKKEFLPPESYENAKRDIEAKLGALRSLLEEVQSKYVALEEGLGAHFKRVLSTSTSAEVISLKLSLSKLDELLKEGKISRETYEKLKKELEELLK GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 74->189|CEP63_CHICK|3e-04|26.7|116/711| SEG 209->223|slklslskldellke| SEG 232->242|eklkkeleell| RP:SCP:NREP 1 RP:SCP:REP 76->183|1hr6A2|1e-04|14.6|103/237|d.185.1.1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -----------------111111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 49-62| PSIPRED cccccccccccccEEEccccccccccEEEEEcccccccEEEEEcccHHHHHccccccccccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHc //