[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63078.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:90 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->61 PF01771 * Herpes_alk_exo 0.00035 37.5 32/465  
:REPEAT 2|3->18|27->41

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63078.1 GT:GENE AAL63078.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(497136..497408) GB:FROM 497136 GB:TO 497408 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63078.1 GB:DB_XREF GI:18159670 LENGTH 90 SQ:AASEQ MIVGDREIDITGLRPIDLMLAALAYGIGIRYIDMEGRPFEMECEIEGYEIKCKAKCTGQEEKCVVYRALTKGTLKFECEEDAHAQGTPKH GT:EXON 1|1-90:0| NREPEAT 1 REPEAT 2|3->18|27->41| HM:PFM:NREP 1 HM:PFM:REP 30->61|PF01771|0.00035|37.5|32/465|Herpes_alk_exo| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 82-90| PSIPRED ccccccEEEEEcccHHHHHHHHHHHHccEEEEEcccccEEEEEEEEcEEEEEEEEccccccEEEEEEEccccEEEEEEcccccccccccc //