[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63102.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:115 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   10->103 PF00015 * MCPsignal 0.00013 19.4 93/213  
:BLT:SWISS 18->101 ATPD_THICR 2e-04 36.1 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63102.1 GT:GENE AAL63102.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(513451..513798) GB:FROM 513451 GB:TO 513798 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63102.1 GB:DB_XREF GI:18159696 LENGTH 115 SQ:AASEQ MSELVKRVESAVRTLAVETLNKFEKKKKVDSIQELIILATYLNMQKLDEVKNDLDNVMRAFQRLDALIDVVKELKKTIESLQAAQTGDVAKLLAEINSKLDRILDKLNIYSVESL GT:EXON 1|1-115:0| BL:SWS:NREP 1 BL:SWS:REP 18->101|ATPD_THICR|2e-04|36.1|83/178| HM:PFM:NREP 1 HM:PFM:REP 10->103|PF00015|0.00013|19.4|93/213|MCPsignal| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccc //