[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63117.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:122 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   32->120 PF02366 * PMT 1.6e-08 22.5 89/245  
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63117.1 GT:GENE AAL63117.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 525864..526232 GB:FROM 525864 GB:TO 526232 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63117.1 GB:DB_XREF GI:18159712 LENGTH 122 SQ:AASEQ MIVLFLTSSYSVGFKFLDEEVYIRAGAQQWSGVPPALTINPEHPPLAKYIIGVEPRLAPLFAGIAVVFLAGWLGRLLGRSFWLVAFSVASDIVFTATSRFAMLDVFVALFSVSAVLSYLLGR GT:EXON 1|1-122:0| TM:NTM 2 TM:REGION 49->71| TM:REGION 90->112| HM:PFM:NREP 1 HM:PFM:REP 32->120|PF02366|1.6e-08|22.5|89/245|PMT| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 17-18,20-20,25-26,31-32,34-34,39-39,67-67,73-74,76-76,81-81| PSIPRED cEEEEEEcccHHHHHHHcccHHEEEccHHccccccEEEEccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //