Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63119.1
DDBJ      :             hypothetical protein

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:112 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63119.1 GT:GENE AAL63119.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 526519..526857 GB:FROM 526519 GB:TO 526857 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63119.1 GB:DB_XREF GI:18159714 LENGTH 112 SQ:AASEQ MPILYNGSEVVTAVSKPGVYDVLKYELRISAAPWLGHLVWRAVPVEIIRGLVGGGAGLGWFLAASSALVAQAGWFYWYFAGVALFFHLYTRRLFVALQIVFIVALYLGMPQC GT:EXON 1|1-112:0| TM:NTM 3 TM:REGION 20->42| TM:REGION 47->69| TM:REGION 93->112| SEG 50->68|glvgggaglgwflaassal| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------11------------------------------------------------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 39-39,45-46,48-48,53-53,67-67,73-74,76-76,101-101,104-104| PSIPRED ccEEEcHHHHHHHHccccHHHHHHHHEEEEccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc //