[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63125.1
DDBJ      :             conserved hypothetical protein
Swiss-Prot:             

Homologs  Archaea  60/68 : Bacteria  302/915 : Eukaryota  193/199 : Viruses  0/175   --->[See Alignment]
b.125.1c.1.28d.108.1
:471 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   21->190 3dfuB PDBj 5e-20 13.7 %
:RPS:PDB   207->458 1bobA PDBj 8e-14 8.5 %
:RPS:SCOP  78->258 1iwmA  b.125.1.2 * 4e-20 13.6 %
:RPS:SCOP  405->458 1y9wA1  d.108.1.1 * 6e-09 35.2 %
:HMM:SCOP  17->273 1oltA_ c.1.28.2 * 2.3e-35 29.5 %
:HMM:SCOP  404->457 1y9wA1 d.108.1.1 * 5.5e-08 31.5 %
:RPS:PFM   121->213 PF04055 * Radical_SAM 2e-13 35.5 %
:HMM:PFM   17->210 PF04055 * Radical_SAM 4.4e-24 26.2 149/166  
:HMM:PFM   361->447 PF00583 * Acetyltransf_1 2.1e-08 26.7 75/83  
:BLT:SWISS 3->457 Y1136_METJA e-115 50.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63125.1 GT:GENE AAL63125.1 GT:PRODUCT conserved hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(532338..533753) GB:FROM 532338 GB:TO 533753 GB:DIRECTION - GB:PRODUCT conserved hypothetical protein GB:NOTE Hypothetical; Conserved GB:PROTEIN_ID AAL63125.1 GB:DB_XREF GI:18159720 LENGTH 471 SQ:AASEQ MASGVHVVALMTQPFPCPGRCTFCPSSADAPKSYMPDSPVVLRAKRNRYDPYLQTAGRIKVYIENGHTPSKIEAVIMGGTFSALPRGYREWFVANIYKALNDFPHWTSSADPTPNLEAEQIRNETAELRMVALTVETRPDFINKAEVDFLLKLGVTRVELGVQSIYDDVLQKVKRGHGAAEVVEATAILKDSAYKVCYHVMPGLPGSDPDRDLEMVREIFSNPSYMPDCVKIYPLYVVPNTELSEDWRRGLYKSYDEETWLELLAKIYASIPRWVRVMRFGRDIPLHHVLDGPRWGNMRQIVLKHMERLGLKCQEIRCREVGIKLANNVPIQPGPVEVKKTEYEASGGLEIFLEAVGPDDTLYAILRLRIPNRPHRPELYKAALVRELHVYGPAVPVGKQGIWWQHSGMGRELMRLAEEIAGEFGALKIAVISGVGVREYYRKLGYERCGPYMCKPLGAPLGVADDGLVAG GT:EXON 1|1-471:0| BL:SWS:NREP 1 BL:SWS:REP 3->457|Y1136_METJA|e-115|50.3|447/541| RP:PDB:NREP 2 RP:PDB:REP 21->190|3dfuB|5e-20|13.7|161/222| RP:PDB:REP 207->458|1bobA|8e-14|8.5|236/306| RP:PFM:NREP 1 RP:PFM:REP 121->213|PF04055|2e-13|35.5|93/164|Radical_SAM| HM:PFM:NREP 2 HM:PFM:REP 17->210|PF04055|4.4e-24|26.2|149/166|Radical_SAM| HM:PFM:REP 361->447|PF00583|2.1e-08|26.7|75/83|Acetyltransf_1| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 78->258|1iwmA|4e-20|13.6|162/177|b.125.1.2| RP:SCP:REP 405->458|1y9wA1|6e-09|35.2|54/140|d.108.1.1| HM:SCP:REP 17->273|1oltA_|2.3e-35|29.5|217/0|c.1.28.2|1/1|Radical SAM enzymes| HM:SCP:REP 404->457|1y9wA1|5.5e-08|31.5|54/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 680 OP:NHOMOORG 555 OP:PATTERN --1-1--111111111-11111-111111111111222222221111111111211111111111-11 ---------------------------------------------------------1--------------------11-1-11111------11-------------1-------------------------------111----------------------1-------------------------11111111111111111-11111111112---111111111111111111111111111111----------------------1111111---111-----------11111111111111--111---111221222222222212112222-2213---21111112-11-111111--11------------------------------------------------------------------------------------1-------------------------------------------------------------------------------------1-----1---11-------------122212222121112333332323------221-----------1-------1111---111--------111-1--11111111-111--------------11111-1111111111-111111111111111111111111--1111111111111111111111111--111111111111-------------------------------------------------------------------------1111111111111----------------------------------1-------------------------2112122222--- 1111111-52211111111111111111111111111111111111111111111112111111111111111111111111111111-111111111111211121121211111-1111111111112C1-21211111-1311111-1111121211222211111131131111181111111121171132221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 460 STR:RPRED 97.7 SQ:SECSTR ####EEEEccccccccccccccTTcEEEccccccGGGHHHHHTTcEEEEEEEETTEEEEEEccHHHHHHHHHHHHHTTcEEccccGGGHHHHHHHHHHHHHHHHHHHEccHccTHHHHHHHHHHHccHHHHHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHTcHHEHHHHHHcccTcccccGGGcEEGGGEEEcccEEEEcccccHHHHTTTTEccEEEEEEETTTccEEEEEEccEEcccTTcccHHHHHHTTccTTccEEcETcHHHHHHHHHHHHHHccTTTTcEEEEEEEETTEEEEEEEEcHHHHTHHHHHHcTTcccccTTcTTEEEEEEEETTTccEEEEEEEEEEcccccccEEEEEEEEcEEEEEEEEEE#####cGGGccccHHHHHHHHHHHHHHHcTTEEEEEEccHHHHHHHHHHHHHHHHHTTHHHHTTcccccTTcEE## DISOP:02AL 1-2| PSIPRED cccccEEEEEEEcccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEccccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccEEEEEEEcccccccHHHHHHHHHccccEEEEccccccHHHHHHHcccccHHHHHHHHHHHHHcccEEEEEEEEccccccHHHHHHHHHHHHHHccccccEEEEEEEEEccccHHHHHHHccccccccHHHHHHHHHHHHHHcccccEEEEEEccccHHHHEEcccccccHHHHHHHHHHcccccEEEEEEEcccccccccccccccEEEEEEEEEccccEEEEEEEEccccEEEEEEEEccccccccHHHcccEEEEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHccEEEccEEEEEccccccccccccccc //