[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63130.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:168 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63130.1 GT:GENE AAL63130.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(535423..535929) GB:FROM 535423 GB:TO 535929 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63130.1 GB:DB_XREF GI:18159726 LENGTH 168 SQ:AASEQ MAFVGILSVIIAWIVNTQAQIVFEEEAKAAAEALLASVVNQLRVGASTASISGVYSFTQQISLPYYSPPFDAFYYAITIRNEQGVLVVYISFEAYRGRASAYVDISKAVYNISALYKPEGYVQIYADLGESYNCRVGDVVNLTRAGCYVKWAMPSPYTVRKVQFIVGS GT:EXON 1|1-168:0| SEG 24->36|eeeakaaaealla| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN ------------------1--1---------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 31-32,34-34,39-40,45-46,48-48,53-53,87-88,90-90,95-96,101-102,104-104,109-109,123-123,129-129,132-132,137-137| PSIPRED ccHHHHHHHHHHHHHcccEEEEEEHHHHHHHHHHHHHHHHHHcccccccEEEEEEEHEEEEEcccccccccEEEEEEEEEcccEEEEEEEEEEEEcccccEEEEHHHHEEEEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEccccccEEEEEEEEEcc //