[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63160.1
DDBJ      :             ATP phosphoribosyltransferase (hisG)
Swiss-Prot:HIS1_PYRAE   RecName: Full=ATP phosphoribosyltransferase;         Short=ATP-PRTase;         Short=ATP-PRT;         EC=2.4.2.17;

Homologs  Archaea  54/68 : Bacteria  699/915 : Eukaryota  113/199 : Viruses  0/175   --->[See Alignment]
c.94.1d.58.5
:282 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   3->281 2vd3A PDBj 1e-55 40.9 %
:RPS:SCOP  1->207 1ve4A1  c.94.1.1 * 1e-50 29.9 %
:RPS:SCOP  210->281 1h3dA2  d.58.5.3 * 2e-08 34.8 %
:HMM:SCOP  1->208 1h3dA1 c.94.1.1 * 4.1e-62 47.6 %
:HMM:SCOP  209->282 1nh8A2 d.58.5.3 * 5.7e-18 40.5 %
:RPS:PFM   49->203 PF01634 * HisG 2e-33 50.6 %
:RPS:PFM   207->280 PF08029 * HisG_C 5e-09 36.5 %
:HMM:PFM   49->203 PF01634 * HisG 9e-51 48.4 155/163  
:HMM:PFM   206->279 PF08029 * HisG_C 3.7e-27 43.2 74/75  
:BLT:SWISS 1->282 HIS1_PYRAE e-156 100.0 %
:PROS 143->164|PS01316|ATP_P_PHORIBOSYLTR

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63160.1 GT:GENE AAL63160.1 GT:PRODUCT ATP phosphoribosyltransferase (hisG) GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 563219..564067 GB:FROM 563219 GB:TO 564067 GB:DIRECTION + GB:PRODUCT ATP phosphoribosyltransferase (hisG) GB:NOTE Amino acid biosynthesis; Histidine family GB:PROTEIN_ID AAL63160.1 GB:DB_XREF GI:18159758 LENGTH 282 SQ:AASEQ MLLAVPSKGRLQEPTLKLLEAVGIRPLASDERALVVPTSWSDVNLIRARPEDIPYLVESGRVWAGITGHDYVVESGSNVAEVLELEFGRGKLVVAVPRSSGITSVEDLPPGARIATKFVNIAYNYFAELGKRVRIIRVTGSVEVLPQLGIADAILDVMATGTTLEVHGLVPIATVLETSARLVVNPQYVEHDLTKKLVTFIKGFYAAQGKKMVFLNVPASRLDAVLAVLPAMEAPSVTKLAKGDVYEVFSVVPEDVLPDLVMKLKEAGARDIVITPIEKLIV GT:EXON 1|1-282:0| SW:ID HIS1_PYRAE SW:DE RecName: Full=ATP phosphoribosyltransferase; Short=ATP-PRTase; Short=ATP-PRT; EC=2.4.2.17; SW:GN Name=hisG; OrderedLocusNames=PAE0961; SW:KW Amino-acid biosynthesis; ATP-binding; Complete proteome; Cytoplasm;Glycosyltransferase; Histidine biosynthesis; Magnesium; Metal-binding;Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->282|HIS1_PYRAE|e-156|100.0|282/282| GO:SWS:NREP 8 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016757|"GO:transferase activity, transferring glycosyl groups"|Glycosyltransferase| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 143->164|PS01316|ATP_P_PHORIBOSYLTR|PDOC01020| BL:PDB:NREP 1 BL:PDB:REP 3->281|2vd3A|1e-55|40.9|279/289| RP:PFM:NREP 2 RP:PFM:REP 49->203|PF01634|2e-33|50.6|154/159|HisG| RP:PFM:REP 207->280|PF08029|5e-09|36.5|74/75|HisG_C| HM:PFM:NREP 2 HM:PFM:REP 49->203|PF01634|9e-51|48.4|155/163|HisG| HM:PFM:REP 206->279|PF08029|3.7e-27|43.2|74/75|HisG_C| GO:PFM:NREP 7 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF01634|IPR013820| GO:PFM GO:0003879|"GO:ATP phosphoribosyltransferase activity"|PF01634|IPR013820| GO:PFM GO:0005737|"GO:cytoplasm"|PF01634|IPR013820| GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF08029|IPR013115| GO:PFM GO:0000287|"GO:magnesium ion binding"|PF08029|IPR013115| GO:PFM GO:0003879|"GO:ATP phosphoribosyltransferase activity"|PF08029|IPR013115| GO:PFM GO:0005737|"GO:cytoplasm"|PF08029|IPR013115| RP:SCP:NREP 2 RP:SCP:REP 1->207|1ve4A1|1e-50|29.9|194/201|c.94.1.1| RP:SCP:REP 210->281|1h3dA2|2e-08|34.8|66/68|d.58.5.3| HM:SCP:REP 1->208|1h3dA1|4.1e-62|47.6|206/0|c.94.1.1|1/1|Periplasmic binding protein-like II| HM:SCP:REP 209->282|1nh8A2|5.7e-18|40.5|74/0|d.58.5.3|1/1|GlnB-like| OP:NHOMO 923 OP:NHOMOORG 866 OP:PATTERN ---1--1111111111-111111-111111111111111111121122111111-1-111-1----11 1111111111111111111-11111111111111111111111111111111111111--211111111111111111--11111111111111-----1-111111111---------------111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-1-1-------111------------------------1----1----11-1111111-1-1111111---1-1--1111111211111111111--1111---------111111111111111111111111-11111111111-11111111111111111-1--1---1-1111111111111111------------------------------111111111111111111111111111111111111111111-111111111111121111111111111111111-1111111111111-2222222121111111111111111111-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----111111111111111-1111---1111111111111111111111111111111--------111111111111111111111111111111111111111--------------------------------------1--1-111111 ------1-----11111111111121111111111111-11--1111111111111111111111111-1111111111111111111-12111111111111211-1--------------------------------------------------1----1------3----1--2U---2121121211112111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 281 STR:RPRED 99.6 SQ:SECSTR EEEEEEcccTTHHHHHHHHHHTTccEEcccTTccEEEEccTTEEEEEEcTTTHHHHHHHTcccEEEEEHHHHHHHTcccEEEEEcccccEEEEEEEETTcccccGGGccTTcEEEEccHHHHHHHHHHTTcccEEEEccccGGGTTTTTcccEEEEEEccTHHHHHTTEEEEEEEEEEcEEEEEcHHHHcHHHHHHHHHHHHHHHHTTTEEEEEEEEEGGGHHHHHHHcccccccEEEEcccccEEEEEEEEETTTHHHHHHHHHTTTcEEEEEEEccccc# PSIPRED cEEEEcccccccHHHHHHHHHcccEEcccccEEEEEEcccccEEEEEEcHHHHHHHHHcccEEEEEEEEEEEEEcccccEEEEccccccEEEEEEEEcccccccHHHHccccEEEEccHHHHHHHHHHccccEEEEEEcccEEEEEcccccEEEEEEEccHHHHHHcccEEEEEEEEEEEEEEEcHHHHccHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHcccccccEEEEEccccEEEEEEEEEHHHHHHHHHHHHHccccEEEEEEEHHEEc //