[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63181.1
DDBJ      :             imidazoleglycerol-phosphate dehydratase
Swiss-Prot:HIS7_PYRAE   RecName: Full=Imidazoleglycerol-phosphate dehydratase;         Short=IGPD;         EC=4.2.1.19;

Homologs  Archaea  55/68 : Bacteria  712/915 : Eukaryota  112/199 : Viruses  0/175   --->[See Alignment]
d.14.1
:186 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->172 2f1dA PDBj 2e-26 38.3 %
:RPS:PDB   4->173 2ae8A PDBj 7e-34 29.8 %
:RPS:SCOP  4->82 2ae8A1  d.14.1.9 * 4e-15 24.3 %
:RPS:SCOP  83->173 1rhyA2  d.14.1.9 * 4e-16 37.4 %
:HMM:SCOP  3->82 2f1dA1 d.14.1.9 * 1.2e-15 48.1 %
:HMM:SCOP  83->175 1rhyA2 d.14.1.9 * 2.5e-29 44.1 %
:RPS:PFM   26->170 PF00475 * IGPD 2e-27 47.2 %
:HMM:PFM   26->170 PF00475 * IGPD 9.8e-50 48.6 144/145  
:BLT:SWISS 1->186 HIS7_PYRAE e-104 100.0 %
:PROS 151->163|PS00955|IGP_DEHYDRATASE_2

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63181.1 GT:GENE AAL63181.1 GT:PRODUCT imidazoleglycerol-phosphate dehydratase GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 579577..580137 GB:FROM 579577 GB:TO 580137 GB:DIRECTION + GB:PRODUCT imidazoleglycerol-phosphate dehydratase GB:NOTE Amino acid biosynthesis; Histidine family GB:PROTEIN_ID AAL63181.1 GB:DB_XREF GI:18159780 LENGTH 186 SQ:AASEQ MPYVRKTLETEVAVELRRGGDLAVETPIPFLTHMLETLLKYAGLGGVVKAVELRKLDDGHHVIEDVAIAVGRALDALLEDRRGIARFGHAVVPMDESIVMAAVDLGGRAYWVVRAKLPDVTIGGYPLRMFPHFVRTLAVEAKATIHIYARGTDPHHKVEAAHKALGLALRQALSPGEGLSTKGVLG GT:EXON 1|1-186:0| SW:ID HIS7_PYRAE SW:DE RecName: Full=Imidazoleglycerol-phosphate dehydratase; Short=IGPD; EC=4.2.1.19; SW:GN Name=hisB; OrderedLocusNames=PAE0990; SW:KW Amino-acid biosynthesis; Complete proteome; Cytoplasm;Histidine biosynthesis; Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|HIS7_PYRAE|e-104|100.0|186/186| GO:SWS:NREP 4 GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0000105|"GO:histidine biosynthetic process"|Histidine biosynthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| PROS 151->163|PS00955|IGP_DEHYDRATASE_2|PDOC00738| BL:PDB:NREP 1 BL:PDB:REP 5->172|2f1dA|2e-26|38.3|167/183| RP:PDB:NREP 1 RP:PDB:REP 4->173|2ae8A|7e-34|29.8|161/166| RP:PFM:NREP 1 RP:PFM:REP 26->170|PF00475|2e-27|47.2|144/145|IGPD| HM:PFM:NREP 1 HM:PFM:REP 26->170|PF00475|9.8e-50|48.6|144/145|IGPD| GO:PFM:NREP 2 GO:PFM GO:0000105|"GO:histidine biosynthetic process"|PF00475|IPR000807| GO:PFM GO:0004424|"GO:imidazoleglycerol-phosphate dehydratase activity"|PF00475|IPR000807| RP:SCP:NREP 2 RP:SCP:REP 4->82|2ae8A1|4e-15|24.3|74/76|d.14.1.9| RP:SCP:REP 83->173|1rhyA2|4e-16|37.4|91/94|d.14.1.9| HM:SCP:REP 3->82|2f1dA1|1.2e-15|48.1|79/0|d.14.1.9|1/2|Ribosomal protein S5 domain 2-like| HM:SCP:REP 83->175|1rhyA2|2.5e-29|44.1|93/0|d.14.1.9|2/2|Ribosomal protein S5 domain 2-like| OP:NHOMO 901 OP:NHOMOORG 879 OP:PATTERN ---1--1111111111-1111111111111111111111111111111211111-1-111-1----11 1111111111111111111-11111111111111111111121111111111111111--111111111111111111--11111111111111-----1-111111111---------------111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111-1----11-1---11--11----1-111-------111------------------------1----1----11-1111111-1-1111111---1-1--1111111111111111111--11111111-----111111111111111111111111-11111111111-1111111111111111111111111111111111111111111-----------------------------11111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111-1111111111111111111111111111-1-------11111111111111111111111111111111111111--111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-1-----111111111111111-1111---1111111111111111111111111111111--------111111111111111111111111111111111111111--------------------------------------1--1-111111 ------1-----221-111111112111111-1111-1111111111111111111111111111111111111-111--11111111-12111111111111111-1--------------------------------------------------1----2-1---------111-8111-11113131-11211- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 172 STR:RPRED 92.5 SQ:SECSTR ##EEEEEEccEEEEEEEccccccEEcccHHHHHHHHHHHHHHccEEEEEEEccTTTccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEETTEEEEEEEEcccccEEEEEccccccEETTEETTHHHHHHHHHHHHTTcEEEEEEEcccHHHHHHHHHHHHHHHHHHHTc############ DISOP:02AL 186-187| PSIPRED ccEEEEcccEEEEEEEcccEEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHcccccccEEEEEEEEHHHHEEEEEEEccccEEEEEEccccccccccccHHHHHHHHHHHHHHcccEEEEEEEEccHHHHHHHHHHHHHHHHHHHcccccccccccccc //