[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63185.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:107 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 32->100 PNP_ORITI 9e-04 33.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63185.1 GT:GENE AAL63185.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION complement(581705..582028) GB:FROM 581705 GB:TO 582028 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63185.1 GB:DB_XREF GI:18159785 LENGTH 107 SQ:AASEQ MDIDKCINECKFKYVRHNIFVSLLDWDTIKRTDELTIEALCDCERPRINAEVFHKTAEGAFHPRLEALVARGWKLKEALAGPIPISCILYYPVRLEREITILIDRRI GT:EXON 1|1-107:0| BL:SWS:NREP 1 BL:SWS:REP 32->100|PNP_ORITI|9e-04|33.3|69/736| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN ------------------1------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHEEEEEcccccccccHHHHHHHHccccccccHHHHHHHccccccHHHHHHHHcccccHHHHcccccEEEEEEEcEEEccEEEEEEEccc //