[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63196.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  0/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:192 amino acids
:PSIPRED
:DISOPRED
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63196.1 GT:GENE AAL63196.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 593897..594475 GB:FROM 593897 GB:TO 594475 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:NOTE Hypothetical GB:PROTEIN_ID AAL63196.1 GB:DB_XREF GI:18159797 LENGTH 192 SQ:AASEQ MPTATSKRRKRGKIFIIALMALIFAETGYILGITGLGPLIFSGMGGATATFKDVLAISTAYVFFNGTVSQAAPPLYQDAYVYVVLYQPGVALPDAVTRQIALDASEKPVYVLPIPSYNTPIDPHDFLDVLPQNAKNPVVLLAYQPTMKTTVDGWLMQVQRWLMQVQSQLGQFQSNYVRVELKGGQPTGVRYF GT:EXON 1|1-192:0| TM:NTM 2 TM:REGION 18->40| TM:REGION 63->85| SEG 14->25|ifiialmalifa| OP:NHOMO 5 OP:NHOMOORG 5 OP:PATTERN ------------------11111--------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 187-190| PSIPRED cccccccHHHccccHHHHHHHHHHHccccEEEEcccHHHHHccccccHHHHHHHHHHHEEEEEEcccHHHcccccccccEEEEEEEcccccccHHHHHHHEEccccccEEEEEcccccccccHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccc //