[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Pyrobaculum aerophilum str. IM2 (paer1)
Gene : AAL63205.1
DDBJ      :             thiamine-monophosphate kinase part 2, authentic frameshift
Swiss-Prot:             

Homologs  Archaea  25/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.139.1d.79.4
:203 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   48->150 2yxzD PDBj 6e-09 35.9 %
:RPS:PDB   1->197 3c9rB PDBj 5e-19 23.4 %
:RPS:SCOP  1->123 1vqvA1  d.79.4.1 * 1e-17 22.1 %
:HMM:SCOP  27->123 1vqvA1 d.79.4.1 * 1.2e-15 36.1 %
:HMM:SCOP  123->201 1vqvA2 d.139.1.1 * 0.00086 21.5 %
:HMM:PFM   42->105 PF00586 * AIRS 2.3e-11 34.4 64/96  
:BLT:SWISS 47->197 THIL_METTH 2e-10 30.5 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID AAL63205.1 GT:GENE AAL63205.1 GT:PRODUCT thiamine-monophosphate kinase part 2, authentic frameshift GT:DATABASE GIB00076CH01 GT:ORG paer1 GB:ACCESSION GIB00076CH01 GB:LOCATION 598946..599557 GB:FROM 598946 GB:TO 599557 GB:DIRECTION + GB:PRODUCT thiamine-monophosphate kinase part 2, authentic frameshift GB:NOTE Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine GB:PROTEIN_ID AAL63205.1 GB:DB_XREF GI:18159806 LENGTH 203 SQ:AASEQ MGEKAFLKGLLNILGVEDNDVVYIDDLAIKLDGSAASTSKLPFQTWRDFGWRNVAAAVSDLRVKFAAPQFLLASVTAPSLEVAREIIEGIKEASEAFSVKYVGGDLNQGVEAVVDVALLGKAQYRIGRVPRPGDLLITVPYFGYTSIAYRLWQIDHPAVLRGVEMLKRPVPNWPLPRPECVTASMDSSDGLATSCGQWPRALT GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 47->197|THIL_METTH|2e-10|30.5|151/327| BL:PDB:NREP 1 BL:PDB:REP 48->150|2yxzD|6e-09|35.9|103/304| RP:PDB:NREP 1 RP:PDB:REP 1->197|3c9rB|5e-19|23.4|197/302| HM:PFM:NREP 1 HM:PFM:REP 42->105|PF00586|2.3e-11|34.4|64/96|AIRS| RP:SCP:NREP 1 RP:SCP:REP 1->123|1vqvA1|1e-17|22.1|122/130|d.79.4.1| HM:SCP:REP 27->123|1vqvA1|1.2e-15|36.1|97/0|d.79.4.1|1/1|PurM N-terminal domain-like| HM:SCP:REP 123->201|1vqvA2|0.00086|21.5|79/0|d.139.1.1|1/1|PurM C-terminal domain-like| OP:NHOMO 26 OP:NHOMOORG 26 OP:PATTERN 11111-1111111111-111111---------------------------111--------------1 --------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 201 STR:RPRED 99.0 SQ:SECSTR HcHHHHHHHHHHHHTccccEEEEETTEEEEEEEEEcTTTccTTccHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHTcEEEEEEEEEccccEEEEEEEEEEcccccccccTTcEEEEcccccHHHHHHHHHTTTcHHHHHHHHHHHcccccGGGHHHHHccEEEEEcccHHHHHHHHHHH## PSIPRED ccHHHHHHHHcccccccccEEEEEccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEEEEEccccccccccccEEEEEccccHHHHHHHHHHccccccHHHHHHHHccccHHHHHHcccccEEEEccHHHHHHHHHHHHHHc //